BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a15r (638 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40070.1 68415.m04923 expressed protein 36 0.030 At3g29080.1 68416.m03641 hypothetical protein 30 1.1 At4g24680.1 68417.m03533 expressed protein 29 2.0 At1g10880.1 68414.m01250 expressed protein contains Pfam profile... 29 2.0 At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f... 29 2.6 At1g74010.1 68414.m08571 strictosidine synthase family protein s... 29 2.6 At1g21730.1 68414.m02720 kinesin-related protein (MKRP1) Similar... 29 2.6 At5g43310.1 68418.m05293 COP1-interacting protein-related contai... 29 3.4 At1g21440.1 68414.m02681 mutase family protein similar to carbox... 29 3.4 At4g08670.1 68417.m01428 protease inhibitor/seed storage/lipid t... 28 4.5 At3g28790.1 68416.m03593 expressed protein 28 4.5 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 28 4.5 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 28 4.5 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 28 6.0 At1g34000.2 68414.m04216 light stress-responsive one-helix prote... 28 6.0 At1g34000.1 68414.m04215 light stress-responsive one-helix prote... 28 6.0 At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldol... 28 6.0 At2g48160.1 68415.m06031 PWWP domain-containing protein 27 7.9 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 35.5 bits (78), Expect = 0.030 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 6/99 (6%) Frame = -2 Query: 601 TRPWSRRLAQSVCTPRIPLVS-SASTGMSNPLTSSL-PWLCLPARTYPNPEMSAALAKST 428 T P S+ +++S R P+ S SA+T +NP S + P PA+ P P + AL+++ Sbjct: 303 TLPPSKTISRSSTPTRRPIASASAATTTANPTISQIKPSSPAPAKPMPTPSKNPALSRAA 362 Query: 427 ANLESN*AASTCPWCP---PTVSLR-PPARKARLPSTML 323 + + PW P P SL PP + LP L Sbjct: 363 SP-----TVRSRPWKPSDMPGFSLETPPNLRTTLPERPL 396 >At3g29080.1 68416.m03641 hypothetical protein Length = 445 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +1 Query: 331 YLEVWPSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSL 480 +L +WPSSL + T + + S S GSP TSP+ + P RS++ Sbjct: 160 FLTIWPSSLQTLACDTFRLTRFTVKSSVSFGSP-TSPETKLIPSLRRSTI 208 >At4g24680.1 68417.m03533 expressed protein Length = 1480 Score = 29.5 bits (63), Expect = 2.0 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +1 Query: 382 GTTDTSKQLSCSPGSPS-TSPKPQTFPDSGRSSLAD--KATGEMKSVGWTS 525 GT+ S + PGSPS S +P + R S AD KA SV W S Sbjct: 63 GTSSLSPRTESGPGSPSHLSNRPSSGGSVTRPSTADSNKAHDSSSSVAWDS 113 >At1g10880.1 68414.m01250 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 651 Score = 29.5 bits (63), Expect = 2.0 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 406 LSCSP-GSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTSLLMLTRPMVSEGCRRTALV 582 LS +P SPS SP P P S S++AD + + W + + PM +E + A + Sbjct: 69 LSSNPLTSPSLSPPPSPSPRSSGSNIAD------EELMWRAAMAPRSPMKNETHPKVAFM 122 Query: 583 SVTR 594 +TR Sbjct: 123 FLTR 126 >At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 631 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +1 Query: 337 EVWPSSLVASRRPSAGTTDTSKQLSCSPG-SPSTSPKPQTFPDSGRSSLADKATGEMKSV 513 E+ SS+V + + T T + C SPS SP P P S LA + E++ + Sbjct: 504 ELVESSMVGAIESRSSTHATIEDPVCEQSPSPSPSPSPSPSPSPSPSVLASECCSEVERI 563 >At1g74010.1 68414.m08571 strictosidine synthase family protein similar to strictosidine synthase [Rauvolfia serpentina][SP|P15324]; contains strictosidine synthase domain PF03088 Length = 325 Score = 29.1 bits (62), Expect = 2.6 Identities = 20/56 (35%), Positives = 33/56 (58%) Frame = -1 Query: 389 VVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAVLLAGADENSAGTFVPVAEYIE 222 V+ A GL +A+ G+ KYD T V++ ++ AG +S G+FV V+E+I+ Sbjct: 169 VLIAVGLKDAS---GKLFKYDPATKAVTELMEGLSGAAGCAVSSDGSFVLVSEFIK 221 >At1g21730.1 68414.m02720 kinesin-related protein (MKRP1) Similar to gb|U06698 neuronal kinesin heavy chain from Homo sapiens and contains a PF|00225 Kinesin motor domain. EST gb|AA042507 comes from this gene; identical to cDNA MKRP1 mRNA for kinesin-related protein, GI:16902291, kinesin-related protein [Arabidopsis thaliana] GI:16902292 Length = 890 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = -2 Query: 550 PLVSSASTGMSNPLTSSLPWLCLPARTYPNPEMSAALAKSTA 425 P S+S ++P+TSS P L R+ P+P S+A A STA Sbjct: 29 PETPSSSHFSASPVTSSSPLL----RSSPSPSTSSAAASSTA 66 >At5g43310.1 68418.m05293 COP1-interacting protein-related contains similarity to COP1-Interacting Protein 7 (CIP7) [Arabidopsis thaliana] GI:3327868 Length = 1237 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 448 QTFPDSGRSSLADKATGEMKSVGWTSLLMLTRPMVSEGCRRTALVS 585 Q FP +G+ S K+TG M + + L R ++ G R T +S Sbjct: 836 QKFPKNGKLSTVSKSTGNMLTRSISPLPPAKRESIATGIRLTRSIS 881 >At1g21440.1 68414.m02681 mutase family protein similar to carboxyvinyl-carboxyphosphonate phosphorylmutase GB:O49290 from [Arabidopsis thaliana]; similar to carboxyphosphonoenolpyruvate mutase (GI:47149) [Streptomyces hygroscopicus]; contains Prosite PS00161: Isocitrate lyase signature Length = 336 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -2 Query: 604 LTRPWSRRLAQSVCT--PRIPLVSSASTGMSNPL 509 +T P A+SVC P+IP+++ A TG N L Sbjct: 95 ITPPEMAATARSVCAAAPKIPIIADADTGGGNAL 128 >At4g08670.1 68417.m01428 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 208 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 376 SAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEM 504 S TT + +S S G+P+TSP P++ +S + T M Sbjct: 130 SGATTPGASPVSPSAGAPTTSPSAAKSPETSATSPSSDETPSM 172 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 28.3 bits (60), Expect = 4.5 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +1 Query: 364 SRRPSAGTT--DTSKQLSCSP-GSPSTSPKPQTFPDSGRSS 477 + + S+G T DT+ S SP GSPS SP P T D SS Sbjct: 355 TNKGSSGDTYKDTTGTSSGSPSGSPSGSPTPSTSTDGKASS 395 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 28.3 bits (60), Expect = 4.5 Identities = 30/115 (26%), Positives = 45/115 (39%), Gaps = 6/115 (5%) Frame = -1 Query: 626 RYGLVVVINPSLVTETSAVRLHPSDTIGLVSINRDVQPT-----DFISPVALSASEDLPE 462 RY + +N +++ D + + + D +P+ D IS S ++D+ E Sbjct: 875 RYSTIDEVNAAILQLEEREHASSGDKVS-IERHSDTKPSNKSSSDVISSNGKSTAKDIRE 933 Query: 461 SGNVCGFGEVDGEPGEQLSCFDVSVVPAD-GLLEATSEEGQTSKYDVGTALVSDD 300 +G G E D + G D D G E SE G YD G SDD Sbjct: 934 NGEAHG-EESDSDSGSGSVVRDGQNEELDDGNHERGSESGDGDDYDDGDGPGSDD 987 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 28.3 bits (60), Expect = 4.5 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +1 Query: 346 PSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKAT 495 PSS +S PS+ + + LS SP SP P P + P S S + +T Sbjct: 90 PSSSPSSAPPSSLSPSSPPPLSLSPSSP-PPPPPSSSPLSSLSPSSSSST 138 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -1 Query: 479 SEDLPESGNVCGFGEVDGEPGEQLSCFDVSVVPADGLLEATSEEGQTSK 333 +E+ P G G + +GE GE+ + +++ G LE S+ +TSK Sbjct: 999 NEETPRLGENGGCNQQNGESGEESTSVTENII--GGKLEQKSKNSETSK 1045 >At1g34000.2 68414.m04216 light stress-responsive one-helix protein (OHP2) contains similarity to photosystem II 22 kDa protein GI:6006279 from [Arabidopsis thaliana] Length = 145 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 367 RRPSAGTTDTSKQLSCSPGSPSTSPKPQTFP 459 RRPSA T Q P PS+SP P P Sbjct: 51 RRPSAPPTLREPQKPVPPSQPSSSPPPSPPP 81 >At1g34000.1 68414.m04215 light stress-responsive one-helix protein (OHP2) contains similarity to photosystem II 22 kDa protein GI:6006279 from [Arabidopsis thaliana] Length = 172 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 367 RRPSAGTTDTSKQLSCSPGSPSTSPKPQTFP 459 RRPSA T Q P PS+SP P P Sbjct: 51 RRPSAPPTLREPQKPVPPSQPSSSPPPSPPP 81 >At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldolase, putative / 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase, putative / DAHP synthetase, putative similar to 3-deoxy-D-arabino-heptulosonate 7-phosphate GI:170224 from [Nicotiana tabacum], SP|P21357 from Solanum tuberosum; contains Pfam Class-II DAHP synthetase family domain PF01474 Length = 527 Score = 27.9 bits (59), Expect = 6.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 604 LTRPWSRRLAQSVCTPRIPLVSSASTGMSNPLTSSLP 494 ++RP S R++ P+ P SSAS + P T + P Sbjct: 29 VSRPTSFRISAVQTDPKTPAASSASAATTTPATLTKP 65 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 27.5 bits (58), Expect = 7.9 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 370 RPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDS--GRSSLADKATGEMKSVGWTSL 528 RP GT+ LS SP PS+SP P P S G ++ D ++ G+ ++ Sbjct: 1123 RPVFGTSHQHMSLS-SPPLPSSSPPPPPAPPSQQGECAMPDSYLNGFENGGYRNV 1176 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,600,729 Number of Sequences: 28952 Number of extensions: 238214 Number of successful extensions: 1009 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -