BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a15f (608 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40070.1 68415.m04923 expressed protein 36 0.028 At1g77010.1 68414.m08968 pentatricopeptide (PPR) repeat-containi... 32 0.34 At3g29080.1 68416.m03641 hypothetical protein 30 1.0 At4g24680.1 68417.m03533 expressed protein 30 1.4 At3g03450.1 68416.m00343 gibberellin response modulator, putativ... 30 1.4 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 30 1.4 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 29 1.8 At1g10880.1 68414.m01250 expressed protein contains Pfam profile... 29 1.8 At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f... 29 2.4 At2g43610.1 68415.m05421 glycoside hydrolase family 19 protein s... 29 2.4 At1g21730.1 68414.m02720 kinesin-related protein (MKRP1) Similar... 29 2.4 At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note:... 29 2.4 At5g43310.1 68418.m05293 COP1-interacting protein-related contai... 29 3.2 At1g21440.1 68414.m02681 mutase family protein similar to carbox... 29 3.2 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 28 4.2 At4g08670.1 68417.m01428 protease inhibitor/seed storage/lipid t... 28 4.2 At3g28790.1 68416.m03593 expressed protein 28 4.2 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 28 4.2 At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identica... 28 4.2 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 28 4.2 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 28 5.6 At1g34000.2 68414.m04216 light stress-responsive one-helix prote... 28 5.6 At1g34000.1 68414.m04215 light stress-responsive one-helix prote... 28 5.6 At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldol... 28 5.6 At3g18500.1 68416.m02351 nocturnin-related contains weak similar... 27 7.4 At2g48160.1 68415.m06031 PWWP domain-containing protein 27 7.4 At2g45880.1 68415.m05706 glycosyl hydrolase family 14 protein si... 27 7.4 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 27 7.4 At5g48400.2 68418.m05985 glutamate receptor family protein (GLR1... 27 9.7 At5g48400.1 68418.m05984 glutamate receptor family protein (GLR1... 27 9.7 At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 27 9.7 At4g18760.1 68417.m02772 leucine-rich repeat family protein cont... 27 9.7 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 27 9.7 At3g57660.1 68416.m06424 DNA-directed RNA polymerase family prot... 27 9.7 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 27 9.7 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 35.5 bits (78), Expect = 0.028 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 6/99 (6%) Frame = +2 Query: 284 TRPWSRRLAQSVCTPRIPLVS-SASTGMSNPLTSSL-PWLCLPARTYPNPEMSAALAKST 457 T P S+ +++S R P+ S SA+T +NP S + P PA+ P P + AL+++ Sbjct: 303 TLPPSKTISRSSTPTRRPIASASAATTTANPTISQIKPSSPAPAKPMPTPSKNPALSRAA 362 Query: 458 ANLESN*AASTCPWCP---PTVSLR-PPARKARLPSTML 562 + + PW P P SL PP + LP L Sbjct: 363 SP-----TVRSRPWKPSDMPGFSLETPPNLRTTLPERPL 396 >At1g77010.1 68414.m08968 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 695 Score = 31.9 bits (69), Expect = 0.34 Identities = 20/74 (27%), Positives = 34/74 (45%) Frame = -3 Query: 405 GRQSHGRDEVSGLDIPVDADETNGIRGVQTDCASLRDQGRVNYHHQTITDPDETDILEAA 226 G+Q H + + G++ D+ + + V C LR +Y + I +PD+ + Sbjct: 206 GKQIHAQILIGGVEC--DSKMNSSLVNVYAKCGDLR---MASYMLEQIREPDDHSLSALI 260 Query: 225 SGAEDPARVNEGTG 184 SG + RVNE G Sbjct: 261 SGYANCGRVNESRG 274 >At3g29080.1 68416.m03641 hypothetical protein Length = 445 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = -1 Query: 554 YLEVWPSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSL 405 +L +WPSSL + T + + S S GSP TSP+ + P RS++ Sbjct: 160 FLTIWPSSLQTLACDTFRLTRFTVKSSVSFGSP-TSPETKLIPSLRRSTI 208 >At4g24680.1 68417.m03533 expressed protein Length = 1480 Score = 29.9 bits (64), Expect = 1.4 Identities = 30/91 (32%), Positives = 40/91 (43%), Gaps = 4/91 (4%) Frame = -1 Query: 503 GTTDTSKQLSCSPGSPS-TSPKPQTFPDSGRSSLAD--KATGEMKSVGWTSLLMLTRPMV 333 GT+ S + PGSPS S +P + R S AD KA SV W S +RP Sbjct: 63 GTSSLSPRTESGPGSPSHLSNRPSSGGSVTRPSTADSNKAHDSSSSVAWDS---NSRPSS 119 Query: 332 SEGCRRTALVSVT-RDGLITTTRP*RTQMKR 243 + G + SV + TRP +Q+ R Sbjct: 120 ASGVFPSNQPSVALQRPHSADTRPGSSQLSR 150 >At3g03450.1 68416.m00343 gibberellin response modulator, putative / gibberellin-responsive modulator, putative similar to GAI (GI:2569938), RGA1 (GB:AAC67333) and RGA2 (GI:2339980) [Arabidopsis thaliana]; possible involvement in nitrogen metabolism Length = 547 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 58 LALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGS 192 + LV + TGV+ +ALVA + +Q +L +A + + T AGS Sbjct: 168 VVLVDSQETGVRLVHALVACAEAIHQENLNLADALVKRVGTLAGS 212 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 29.9 bits (64), Expect = 1.4 Identities = 36/132 (27%), Positives = 47/132 (35%), Gaps = 1/132 (0%) Frame = +2 Query: 161 PVVCSTPAPVPSFTLAGSSAPLAAXXXXXXXXXXXXXXXXLTRPWSRRLAQSVCTPRIPL 340 P+ +P P + S +PLA L P RL R+P Sbjct: 394 PLYRRNRSPSPLYRRNRSRSPLAKRGRSDSPGRSPSPVARLRDPTGARLPSPSIEQRLPS 453 Query: 341 VSSASTGMSNP-LTSSLPWLCLPARTYPNPEMSAALAKSTANLESN*AASTCPWCPPTVS 517 A S P + LP PA+ P+P A S + + AA+ P S Sbjct: 454 PPVAQRLPSPPPRRAGLP-SPPPAQRLPSPPPRRAGLPSPMRIGGSHAANHLE-SPSPSS 511 Query: 518 LRPPARKARLPS 553 L PP RK LPS Sbjct: 512 LSPPGRKKVLPS 523 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +2 Query: 116 SETSPTRSIYASLF--RPVVCSTPAPVPSFTLAGS-SAP 223 S +S T S +S+F P + S+P+P P+FT A S SAP Sbjct: 162 SSSSSTSSSSSSIFPTNPHIYSSPSPPPTFTTATSDSAP 200 >At1g10880.1 68414.m01250 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 651 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = -1 Query: 479 LSCSP-GSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTSLLMLTRPMVSEGCRRTALV 303 LS +P SPS SP P P S S++AD + + W + + PM +E + A + Sbjct: 69 LSSNPLTSPSLSPPPSPSPRSSGSNIAD------EELMWRAAMAPRSPMKNETHPKVAFM 122 Query: 302 SVTR 291 +TR Sbjct: 123 FLTR 126 >At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 631 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -1 Query: 548 EVWPSSLVASRRPSAGTTDTSKQLSCSPG-SPSTSPKPQTFPDSGRSSLADKATGEMKSV 372 E+ SS+V + + T T + C SPS SP P P S LA + E++ + Sbjct: 504 ELVESSMVGAIESRSSTHATIEDPVCEQSPSPSPSPSPSPSPSPSPSVLASECCSEVERI 563 >At2g43610.1 68415.m05421 glycoside hydrolase family 19 protein similar to chitinase GI:17799 from [Brassica napus]; contains Pfam profiles PF00182: Chitinase class I, PF00187: Chitin recognition protein Length = 281 Score = 29.1 bits (62), Expect = 2.4 Identities = 28/109 (25%), Positives = 38/109 (34%) Frame = -1 Query: 533 SLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTSLL 354 ++ SR GTT C G ++ PKP P SG L G + SV + Sbjct: 39 NMCCSRWGYCGTTKAYCGTGCQSGPCNSKPKPTPTP-SGSGGLNAGPRGTIASVITPAFF 97 Query: 353 MLTRPMVSEGCRRTALVSVTRDGLITTTRP*RTQMKRTSWRQLAALRTQ 207 V GC A TR I + R++AA+ Q Sbjct: 98 NSIMSKVGSGC--PAKGFYTRQAFIAAAESFAAYKGTVAKREIAAMLAQ 144 >At1g21730.1 68414.m02720 kinesin-related protein (MKRP1) Similar to gb|U06698 neuronal kinesin heavy chain from Homo sapiens and contains a PF|00225 Kinesin motor domain. EST gb|AA042507 comes from this gene; identical to cDNA MKRP1 mRNA for kinesin-related protein, GI:16902291, kinesin-related protein [Arabidopsis thaliana] GI:16902292 Length = 890 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +2 Query: 335 PLVSSASTGMSNPLTSSLPWLCLPARTYPNPEMSAALAKSTA 460 P S+S ++P+TSS P L R+ P+P S+A A STA Sbjct: 29 PETPSSSHFSASPVTSSSPLL----RSSPSPSTSSAAASSTA 66 >At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note: CHX6a and CHX6b were originally 1 gene but were split pased on alignments with other family members; may be a pseudogene and requires futher investigation; monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 818 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -3 Query: 297 DQGRVNYHHQTITDPDETD-ILEAASGAEDPARVNEGTGAGVEQTTG 160 + +V Y + ++D ET IL A + D V G+G G E T+G Sbjct: 724 NDAKVTYIDKAVSDGSETSRILRAMANDYDLFIVGSGSGIGTEATSG 770 >At5g43310.1 68418.m05293 COP1-interacting protein-related contains similarity to COP1-Interacting Protein 7 (CIP7) [Arabidopsis thaliana] GI:3327868 Length = 1237 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -1 Query: 437 QTFPDSGRSSLADKATGEMKSVGWTSLLMLTRPMVSEGCRRTALVS 300 Q FP +G+ S K+TG M + + L R ++ G R T +S Sbjct: 836 QKFPKNGKLSTVSKSTGNMLTRSISPLPPAKRESIATGIRLTRSIS 881 >At1g21440.1 68414.m02681 mutase family protein similar to carboxyvinyl-carboxyphosphonate phosphorylmutase GB:O49290 from [Arabidopsis thaliana]; similar to carboxyphosphonoenolpyruvate mutase (GI:47149) [Streptomyces hygroscopicus]; contains Prosite PS00161: Isocitrate lyase signature Length = 336 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +2 Query: 281 LTRPWSRRLAQSVCT--PRIPLVSSASTGMSNPL 376 +T P A+SVC P+IP+++ A TG N L Sbjct: 95 ITPPEMAATARSVCAAAPKIPIIADADTGGGNAL 128 >At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 182 Score = 28.3 bits (60), Expect = 4.2 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 83 PVCKVPTPWLPSETSPTRSIYA-SLFRPVVCSTPAPVPSFT 202 P KVPTP +PS PT S+ + S+ P V S P P+ T Sbjct: 45 PSPKVPTPSVPSPYVPTPSVPSPSVPTPSVPSPSVPSPNPT 85 >At4g08670.1 68417.m01428 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 208 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 509 SAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEM 381 S TT + +S S G+P+TSP P++ +S + T M Sbjct: 130 SGATTPGASPVSPSAGAPTTSPSAAKSPETSATSPSSDETPSM 172 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 28.3 bits (60), Expect = 4.2 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = -1 Query: 521 SRRPSAGTT--DTSKQLSCSP-GSPSTSPKPQTFPDSGRSS 408 + + S+G T DT+ S SP GSPS SP P T D SS Sbjct: 355 TNKGSSGDTYKDTTGTSSGSPSGSPSGSPTPSTSTDGKASS 395 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 28.3 bits (60), Expect = 4.2 Identities = 30/115 (26%), Positives = 45/115 (39%), Gaps = 6/115 (5%) Frame = +1 Query: 259 RYGLVVVINPSLVTETSAVRLHPSDTIGLVSINRDVQPT-----DFISPVALSASEDLPE 423 RY + +N +++ D + + + D +P+ D IS S ++D+ E Sbjct: 875 RYSTIDEVNAAILQLEEREHASSGDKVS-IERHSDTKPSNKSSSDVISSNGKSTAKDIRE 933 Query: 424 SGNVCGFGEVDGEPGEQLSCFDVSVVPAD-GLLEATSEEGQTSKYDVGTALVSDD 585 +G G E D + G D D G E SE G YD G SDD Sbjct: 934 NGEAHG-EESDSDSGSGSVVRDGQNEELDDGNHERGSESGDGDDYDDGDGPGSDD 987 >At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identical to gi|3883122|gb|AAC77824; supported by cDNA gi|3883121|gb|AF082299 Length = 131 Score = 28.3 bits (60), Expect = 4.2 Identities = 20/49 (40%), Positives = 23/49 (46%) Frame = +2 Query: 77 AAPVCKVPTPWLPSETSPTRSIYASLFRPVVCSTPAPVPSFTLAGSSAP 223 A+P V P TSPT S AS P PAP PS L +S+P Sbjct: 50 ASPPVPVNEPTPAPTTSPTTSPVAS---PPQTDAPAPGPSAGLTPTSSP 95 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 28.3 bits (60), Expect = 4.2 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -1 Query: 539 PSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKAT 390 PSS +S PS+ + + LS SP SP P P + P S S + +T Sbjct: 90 PSSSPSSAPPSSLSPSSPPPLSLSPSSP-PPPPPSSSPLSSLSPSSSSST 138 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 406 SEDLPESGNVCGFGEVDGEPGEQLSCFDVSVVPADGLLEATSEEGQTSK 552 +E+ P G G + +GE GE+ + +++ G LE S+ +TSK Sbjct: 999 NEETPRLGENGGCNQQNGESGEESTSVTENII--GGKLEQKSKNSETSK 1045 >At1g34000.2 68414.m04216 light stress-responsive one-helix protein (OHP2) contains similarity to photosystem II 22 kDa protein GI:6006279 from [Arabidopsis thaliana] Length = 145 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 518 RRPSAGTTDTSKQLSCSPGSPSTSPKPQTFP 426 RRPSA T Q P PS+SP P P Sbjct: 51 RRPSAPPTLREPQKPVPPSQPSSSPPPSPPP 81 >At1g34000.1 68414.m04215 light stress-responsive one-helix protein (OHP2) contains similarity to photosystem II 22 kDa protein GI:6006279 from [Arabidopsis thaliana] Length = 172 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 518 RRPSAGTTDTSKQLSCSPGSPSTSPKPQTFP 426 RRPSA T Q P PS+SP P P Sbjct: 51 RRPSAPPTLREPQKPVPPSQPSSSPPPSPPP 81 >At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldolase, putative / 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase, putative / DAHP synthetase, putative similar to 3-deoxy-D-arabino-heptulosonate 7-phosphate GI:170224 from [Nicotiana tabacum], SP|P21357 from Solanum tuberosum; contains Pfam Class-II DAHP synthetase family domain PF01474 Length = 527 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 281 LTRPWSRRLAQSVCTPRIPLVSSASTGMSNPLTSSLP 391 ++RP S R++ P+ P SSAS + P T + P Sbjct: 29 VSRPTSFRISAVQTDPKTPAASSASAATTTPATLTKP 65 >At3g18500.1 68416.m02351 nocturnin-related contains weak similarity to Nocturnin (CCR4 protein homolog) (Swiss-Prot:O35710) [Mus musculus] Length = 262 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 160 TSGLLNTCAGSLIHSRWVLSAASCLQDVRFIWVRYGLVVV 279 T L + G ++HS LS+ S + R+ WV + ++ Sbjct: 218 TLSLASLVCGIMLHSLLFLSSGSLISQERYCWVTFTCFII 257 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 27.5 bits (58), Expect = 7.4 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = -1 Query: 515 RPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDS--GRSSLADKATGEMKSVGWTSL 357 RP GT+ LS SP PS+SP P P S G ++ D ++ G+ ++ Sbjct: 1123 RPVFGTSHQHMSLS-SPPLPSSSPPPPPAPPSQQGECAMPDSYLNGFENGGYRNV 1176 >At2g45880.1 68415.m05706 glycosyl hydrolase family 14 protein similar to beta-amylase GI:13560977 from [Castanea crenata] Length = 691 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 87 CAKYQRPGCPRRQA--LPGPSTHRCFDQWSAQHLRRFPHS 200 C + + P CP + PG +C+D++ ++ LR+ S Sbjct: 420 CGELRYPSCPIKHGWRYPGVGEFQCYDKYLSKSLRKAAES 459 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 98 PTPWLPSETSPTRSIYASLFRP-VVCSTPAPVPSFTLAGSSAP 223 P P++ S P +Y S P V +P P PS++ + SS P Sbjct: 432 PPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPP 474 >At5g48400.2 68418.m05985 glutamate receptor family protein (GLR1.2) plant glutamate receptor family, PMID:11379626 Length = 867 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -1 Query: 542 WPSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSL 405 W S+ S R +T + + PG + SPK ++ +SGR L Sbjct: 397 WNSNGSFSNRRQLSSTHDNLETIIWPGGSAQSPKGRSLRESGRKKL 442 >At5g48400.1 68418.m05984 glutamate receptor family protein (GLR1.2) plant glutamate receptor family, PMID:11379626 Length = 750 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -1 Query: 542 WPSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSL 405 W S+ S R +T + + PG + SPK ++ +SGR L Sbjct: 397 WNSNGSFSNRRQLSSTHDNLETIIWPGGSAQSPKGRSLRESGRKKL 442 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 38 LLYYCAVLLWYRGAAPVCKVPTPWLPSETSPTRSIYASLFRPVVCS 175 + ++ ++LL + A V K T W SP I +SLF + C+ Sbjct: 9 ITFFLSLLLRFSSAQTVVKA-TYWFAESESPLAQIDSSLFTHLFCA 53 >At4g18760.1 68417.m02772 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 431 Score = 27.1 bits (57), Expect = 9.7 Identities = 22/77 (28%), Positives = 31/77 (40%) Frame = -1 Query: 506 AGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTSLLMLTRPMVSE 327 + T + LS +P SP+TSP P P S S L K ++S L P V + Sbjct: 16 SATISAAPSLSPTP-SPTTSPIPPHKPSSSSSPLDPKQLKALES--------LNIPTVKD 66 Query: 326 GCRRTALVSVTRDGLIT 276 C T ++T Sbjct: 67 PCNHRPTTKSTSSSVVT 83 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 27.1 bits (57), Expect = 9.7 Identities = 18/63 (28%), Positives = 26/63 (41%) Frame = -1 Query: 539 PSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTS 360 PS S PS+ S + +P S + +P P P S + A K +G T Sbjct: 155 PSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAPLPPSLSPNAASKGVMSYGIIGVTM 214 Query: 359 LLM 351 +LM Sbjct: 215 ILM 217 >At3g57660.1 68416.m06424 DNA-directed RNA polymerase family protein similar to SP|O35134 DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6) (RNA polymerase I 194 kDa subunit) (RPA194) {Mus musculus}; contains InterPro accession IPR000722: RNA polymerase, alpha subunit Length = 1670 Score = 27.1 bits (57), Expect = 9.7 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 5/87 (5%) Frame = -3 Query: 411 LAGRQSHGRDEVSGLDIPVDAD---ETNGIRGVQTDCASLRDQGRVNYHHQTITDPDETD 241 +AG ++ D VSG D D E + + +D + Q ++ ++ DET+ Sbjct: 1321 IAGNETDNDDSVSGKQNEDDGDDDGEGTEVDDLGSDAQKQKKQETDEMDYEENSE-DETN 1379 Query: 240 ILEAASGAEDPA--RVNEGTGAGVEQT 166 + SG EDP NE T E T Sbjct: 1380 EPSSISGVEDPEMDSENEDTEVSKEDT 1406 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 27.1 bits (57), Expect = 9.7 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 470 SPGSPSTSPKPQTFPDS 420 SP SP++SPKP++ DS Sbjct: 127 SPQSPASSPKPESLADS 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,624,468 Number of Sequences: 28952 Number of extensions: 351698 Number of successful extensions: 1409 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1404 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -