BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a12r (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation facto... 68 6e-14 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 25 0.73 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 9.0 >AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation factor 1-alpha protein. Length = 56 Score = 68.1 bits (159), Expect = 6e-14 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 487 LQDVYKIGGIGTVPVGRVETGVLKPGTIVVFDPA 386 LQDVYKIGGIGTVPVGRVETGVLKPG +VVF PA Sbjct: 1 LQDVYKIGGIGTVPVGRVETGVLKPGMVVVFAPA 34 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 24.6 bits (51), Expect = 0.73 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +2 Query: 419 QHTSFN-SADGHGTNTTDFVYVLQ 487 ++ SFN +A+GHG NT+ Y Q Sbjct: 280 EYNSFNWTANGHGHNTSSHNYYAQ 303 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 433 ETGVLKPGTIVVFDPAIVAP 374 ETG ++PG I P + P Sbjct: 96 ETGSIRPGVIGGSKPRVATP 115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,306 Number of Sequences: 336 Number of extensions: 2366 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -