BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a12r (659 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 25 2.1 EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein. 25 2.1 EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein. 25 2.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.8 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 4.9 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 6.5 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 25.0 bits (52), Expect = 2.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +3 Query: 375 GATMAGSKTTMVPGFNTPVSTLPTGTVPIPPILYTSCRG 491 G + + T PG P+S L G V P YT+ G Sbjct: 444 GPDRSPATLTPSPGIGGPISPLDPGNVTPTPPAYTTLGG 482 >EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 25.0 bits (52), Expect = 2.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 504 SPCVFPCKTYTKSVVLVP 451 +PC+ PCK + + V +P Sbjct: 23 NPCLCPCKPFEEKVYFIP 40 >EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 2.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 543 LSMPSCHLPAPLTSPCVFPCKTYTKSVVLVP 451 LS P P +PC+ PCK + + +P Sbjct: 10 LSGPHTVDDIPQQNPCLCPCKPFEEKEYFIP 40 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 2.8 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -3 Query: 570 KLTENASLKLSMPSCHLPAP--LTSPCVFPCKTYTKSVVLVPCPSAELK 430 +L + L +PSC LP P + P P KS C + L+ Sbjct: 90 ELVTRSLSNLELPSCRLPCPNLIPRPAEVPTTPEHKSAASSSCSLSTLE 138 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.8 bits (49), Expect = 4.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 Query: 526 PPARPTDKPLRLP 488 P +RPT KP RLP Sbjct: 289 PRSRPTSKPKRLP 301 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.4 bits (48), Expect = 6.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 412 LVSTHQFQLCRRARYQYHRFCIRLAGEDAGACQWGGQVAGWHR 540 + T+ +LC +Q H RL G G+ G +HR Sbjct: 191 ITRTNAERLCSSLLHQAHELRPRLKGGGPGSALLNGSFRVYHR 233 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 577,734 Number of Sequences: 2352 Number of extensions: 11539 Number of successful extensions: 68 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -