BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a11r (640 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 25 0.82 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 22 4.4 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 4.4 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 24.6 bits (51), Expect = 0.82 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -2 Query: 183 SVRTNHLVGRRCGNIWEAELSNCNGGTLHMGNGNFGKRGSG 61 ++ + H + +C + +E NCN G+L + NF + G Sbjct: 73 TITSYHRINLKCSLVEFSENKNCNAGSLTV-KKNFANKYCG 112 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 378 WGGNSNALNRNAGHYVECI 322 + GN N + N YVEC+ Sbjct: 48 YNGNVNVEDENVQSYVECM 66 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 21 FRKARRCEFSNRRGRIR 71 F+ RC+ SN+R R R Sbjct: 74 FKSLPRCQLSNKRDRSR 90 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,065 Number of Sequences: 438 Number of extensions: 5167 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -