BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a11f (617 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 3.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 3.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 3.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 3.6 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 8.3 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 21 8.3 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.2 bits (45), Expect = 3.6 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 94 NSHYVEGESRYIWMPDGEGVPQLVDLHEPIDYELLGSRSGA 216 +S + GE+ YI DG+ Q LH +DY GA Sbjct: 146 HSKEIRGENTYILALDGDIDFQPEALHLLVDYMKKNKTLGA 186 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 3.6 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 94 NSHYVEGESRYIWMPDGEGVPQLVDLHEPIDYELLGSRSGA 216 +S + GE+ YI DG+ Q LH +DY GA Sbjct: 460 HSKEIRGENTYILALDGDIDFQPEALHLLVDYMKKNKTLGA 500 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.6 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 94 NSHYVEGESRYIWMPDGEGVPQLVDLHEPIDYELLGSRSGA 216 +S + GE+ YI DG+ Q LH +DY GA Sbjct: 693 HSKEIRGENTYILALDGDIDFQPEALHLLVDYMKKNKTLGA 733 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.6 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 94 NSHYVEGESRYIWMPDGEGVPQLVDLHEPIDYELLGSRSGA 216 +S + GE+ YI DG+ Q LH +DY GA Sbjct: 693 HSKEIRGENTYILALDGDIDFQPEALHLLVDYMKKNKTLGA 733 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +3 Query: 3 YTVSHHETLHS 35 Y +HH+TLH+ Sbjct: 10 YFTTHHDTLHN 20 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +3 Query: 3 YTVSHHETLHS 35 Y +HH+TLH+ Sbjct: 10 YFTTHHDTLHN 20 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,465 Number of Sequences: 336 Number of extensions: 3314 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -