BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a10r (596 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48520.2 68414.m05423 glutamyl-tRNA(Gln) amidotransferase B f... 31 0.44 At4g25540.1 68417.m03682 DNA mismatch repair protein MSH3 (MSH3)... 31 0.77 At1g48520.3 68414.m05424 glutamyl-tRNA(Gln) amidotransferase B f... 30 1.0 At1g48520.1 68414.m05425 glutamyl-tRNA(Gln) amidotransferase B f... 30 1.0 At2g13560.1 68415.m01495 malate oxidoreductase, putative similar... 29 1.8 At4g17740.2 68417.m02649 C-terminal processing protease, putativ... 28 4.1 At3g49200.1 68416.m05377 hypothetical protein 28 4.1 At1g49590.1 68414.m05560 formin-binding protein-related similar ... 28 5.4 At1g44446.3 68414.m05115 chlorophyll a oxygenase (CAO) / chlorop... 28 5.4 At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorop... 28 5.4 At1g44446.1 68414.m05113 chlorophyll a oxygenase (CAO) / chlorop... 28 5.4 At4g00350.1 68417.m00046 MATE efflux family protein similar to r... 27 7.2 At2g45000.1 68415.m05603 expressed protein contains Pfam profile... 27 7.2 At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PG... 27 7.2 At2g01570.1 68415.m00081 gibberellin response modulator (RGA1) /... 27 7.2 At3g49190.1 68416.m05376 condensation domain-containing protein ... 27 9.5 At2g43220.1 68415.m05372 DC1 domain-containing protein contains ... 27 9.5 At1g55700.1 68414.m06378 DC1 domain-containing protein contains ... 27 9.5 >At1g48520.2 68414.m05423 glutamyl-tRNA(Gln) amidotransferase B family protein contains Pfam profiles: PF02934 PET112 family, N terminal region, PF02637 GatB/Yqey domain, PF01162 PET112 family, C terminal region Length = 475 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -2 Query: 592 SSIATFLKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVARITG 458 S IA +LKN KL +N + + L +A + + GK+ + G Sbjct: 420 SDIAAYLKNEKLSINDIKLTPQELAELIAAIKDGTISGKIGKEVG 464 >At4g25540.1 68417.m03682 DNA mismatch repair protein MSH3 (MSH3) identical to SP|O65607 DNA mismatch repair protein MSH3 (AtMsh3) {Arabidopsis thaliana} Length = 1081 Score = 30.7 bits (66), Expect = 0.77 Identities = 22/84 (26%), Positives = 33/84 (39%), Gaps = 4/84 (4%) Frame = -2 Query: 430 NNVLRLGTNDAQYVEVIHTDGSGVNKNGLGIAIGHIDFFVNGRLVQPGCTNNLCSHN--- 260 N + L N Q +EV+ + G L + H RL++ T+ LC N Sbjct: 417 NTEMTLSANTLQQLEVVKNNSDGSESGSLFHNMNHTLTVYGSRLLRHWVTHPLCDRNLIS 476 Query: 259 -RAYEVFAATITHGKHYGNQCSTE 191 R V + G H +Q S+E Sbjct: 477 ARLDAVSEISACMGSHSSSQLSSE 500 >At1g48520.3 68414.m05424 glutamyl-tRNA(Gln) amidotransferase B family protein contains Pfam profiles: PF02934 PET112 family, N terminal region, PF02637 GatB/Yqey domain, PF01162 PET112 family, C terminal region Length = 488 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 592 SSIATFLKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVAR 467 S IA +LKN KL +N + + L +A + + GK+ + Sbjct: 420 SDIAAYLKNEKLSINDIKLTPQELAELIAAIKDGTISGKIGK 461 >At1g48520.1 68414.m05425 glutamyl-tRNA(Gln) amidotransferase B family protein contains Pfam profiles: PF02934 PET112 family, N terminal region, PF02637 GatB/Yqey domain, PF01162 PET112 family, C terminal region Length = 550 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 592 SSIATFLKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVAR 467 S IA +LKN KL +N + + L +A + + GK+ + Sbjct: 420 SDIAAYLKNEKLSINDIKLTPQELAELIAAIKDGTISGKIGK 461 >At2g13560.1 68415.m01495 malate oxidoreductase, putative similar to NAD-dependent malic enzyme 62 kDa isoform, mitochondrial precursor (EC 1.1.1.39) (NAD-ME) (SP:P37221) {Solanum tuberosum} Length = 623 Score = 29.5 bits (63), Expect = 1.8 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 7/79 (8%) Frame = -2 Query: 505 GVTGRNLEGKVARITGLDPSARDWENNVLRLGTNDAQYVE-VIHTDGSGV------NKNG 347 G+ +N G R G+ SA D + + A+ V+ ++ TDGS + +G Sbjct: 148 GLVCQNYSGLFRRPRGMYFSAEDRGEMMSMVYNWPAEQVDMIVVTDGSRILGLGDLGVHG 207 Query: 346 LGIAIGHIDFFVNGRLVQP 290 +GIA+G +D +V + P Sbjct: 208 IGIAVGKLDLYVAAAGINP 226 >At4g17740.2 68417.m02649 C-terminal processing protease, putative similar to C-terminal protease precursor [Spinacia oleracea] GI:999435; similar to SP|Q44879| (Bartonella bacilliformis) Length = 505 Score = 28.3 bits (60), Expect = 4.1 Identities = 25/94 (26%), Positives = 43/94 (45%) Frame = +3 Query: 309 LTKKSMCPIAMPKPFLLTPDPSV*ITSTY*ASFVPSRSTLFSQSRAEGSRPVILATLPSK 488 L S+ PI+ KP + P+ S+ I+ S+ SRS + SR+ + P ++ ++ Sbjct: 4 LASSSLSPISFTKPNKINPNFSIQISKASKFSYARSRSNI---SRSNAANPGVVFVC-NR 59 Query: 489 FLPVTPAT*APRLKPTMCTLLSGNLRFFKKVAIL 590 FL V +L + S N R VA++ Sbjct: 60 FLCVIERNDQRKLSGKVMMKSSVNFRQNLSVALV 93 >At3g49200.1 68416.m05377 hypothetical protein Length = 507 Score = 28.3 bits (60), Expect = 4.1 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 5/56 (8%) Frame = -2 Query: 487 LEGKVARITG--LDPSARDWENNVLRLGTNDAQYVEVI---HTDGSGVNKNGLGIA 335 LE V+ +T LD S WE ++L L T+DA+ V V+ H+ G G++ L +A Sbjct: 120 LESYVSDLTTIPLDTSKPLWEVHLLDLKTSDAENVAVLRIHHSLGDGMSMMSLVLA 175 >At1g49590.1 68414.m05560 formin-binding protein-related similar to formin binding protein 21 (GI:3550080) [Homo sapiens]; similar to formin binding protein 21 (GI:3550077) [Mus musculus]; similar to Dinap1-interacting protein 1 (GI:8745458) [Crypthecodinium cohnii] Length = 242 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 161 ISS*NGYCQTCKAWVWNVPSKYRH 90 +S N +C+ CK W+ N P+ R+ Sbjct: 6 VSQGNKWCEFCKIWIQNNPTSIRN 29 >At1g44446.3 68414.m05115 chlorophyll a oxygenase (CAO) / chlorophyll b synthase identical to chlorophyll a oxygenase GI:5853117 from [Arabidopsis thaliana]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 433 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = -2 Query: 295 QPGCTNNLCSHNRAYEVFAATITHGK----HYGNQCSTEAE 185 +PGC N C+H RA + T+ G+ ++G + ST+ E Sbjct: 254 KPGCVRNTCAH-RACPLDLGTVNEGRIQCPYHGWEYSTDGE 293 >At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorophyll b synthase identical to chlorophyll a oxygenase GI:5853117 from [Arabidopsis thaliana]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 511 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = -2 Query: 295 QPGCTNNLCSHNRAYEVFAATITHGK----HYGNQCSTEAE 185 +PGC N C+H RA + T+ G+ ++G + ST+ E Sbjct: 254 KPGCVRNTCAH-RACPLDLGTVNEGRIQCPYHGWEYSTDGE 293 >At1g44446.1 68414.m05113 chlorophyll a oxygenase (CAO) / chlorophyll b synthase identical to chlorophyll a oxygenase GI:5853117 from [Arabidopsis thaliana]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 536 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = -2 Query: 295 QPGCTNNLCSHNRAYEVFAATITHGK----HYGNQCSTEAE 185 +PGC N C+H RA + T+ G+ ++G + ST+ E Sbjct: 254 KPGCVRNTCAH-RACPLDLGTVNEGRIQCPYHGWEYSTDGE 293 >At4g00350.1 68417.m00046 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554 Uncharacterized membrane protein family Length = 542 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +1 Query: 22 ILLVITENFVLSFV-GITNGMGTSCRYLLGTFQTHALQVWQYPFQLEILGNYLRLSPL 192 I L + NF F+ G+ + + T C G Q L V+ L +LG + L PL Sbjct: 130 IALSVVSNFSFGFLLGMASALETLCGQAFGAGQMDMLGVYMQRSWLILLGTSVCLLPL 187 >At2g45000.1 68415.m05603 expressed protein contains Pfam profile: PF05064 Nsp1-like C-terminal region Length = 739 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 354 LLTPDPSV*ITSTY*ASFVPSRSTLFSQSRAEGSRPVILATLPSKFLPVTPAT 512 L + P+ T+++ VP ST S S+ + + P +LPS PAT Sbjct: 451 LASSTPATGSTNSFTGFAVPKTSTPASSSQPQTTSPAFSFSLPSSTSTTAPAT 503 >At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PGP1) identical to P-glycoprotein GI:3849833 from [Arabidopsis thaliana]; homologous to mammalian mdr gene,contains ATP-binding cassette; related to multi drug resistance proteins Length = 1286 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 247 VFAATITHGKHYGNQCSTEAEI 182 +F TI YG++C+TEAEI Sbjct: 1111 LFGTTIYENIAYGHECATEAEI 1132 >At2g01570.1 68415.m00081 gibberellin response modulator (RGA1) / gibberellin-responsive modulator identical to GB:Y11336, member of SCARECROW family Length = 587 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 469 RITGLDPSARDWENNVLRLGTNDAQYVEVIHTD 371 R+TG+ P A D +++ +G AQ E IH + Sbjct: 354 RLTGIGPPAPDNSDHLHEVGCKLAQLAEAIHVE 386 >At3g49190.1 68416.m05376 condensation domain-containing protein contains Pfam profile PF00668: Condensation domain Length = 522 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -2 Query: 457 LDPSARDWENNVLRLGTNDAQYVEVI---HTDGSGVNKNGLGIA 335 LD S WE ++L L T+DA+ V V+ H+ G G++ L +A Sbjct: 120 LDTSRPLWELHLLDLKTSDAENVAVLKIHHSVGDGMSIMSLVLA 163 >At2g43220.1 68415.m05372 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 538 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 72 KWNGYLMPVFTRNIPDPCFTSLAVPISTRNP 164 KW+ Y +P T+NI PC + + + + P Sbjct: 46 KWHPYCVPRSTKNINHPCHPNHPLEVLLQGP 76 >At1g55700.1 68414.m06378 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 679 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 143 YCQTCKAWVWNVPSKYRHEVPIPFVMPTKLKTKFS 39 +C TC+ V + Y HE+ PF LK FS Sbjct: 110 HCPTCEMCYHKVCNLYPHEIRHPFHAQHPLKLTFS 144 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,647,327 Number of Sequences: 28952 Number of extensions: 266040 Number of successful extensions: 698 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -