BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a08r (650 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P58146 Cluster: Uncharacterized 15.7 kDa protein in rpl... 36 0.64 UniRef50_O77393 Cluster: Putative uncharacterized protein MAL3P6... 35 1.9 UniRef50_Q8IJ33 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 UniRef50_Q7RT07 Cluster: Putative uncharacterized protein PY0019... 33 7.8 >UniRef50_P58146 Cluster: Uncharacterized 15.7 kDa protein in rpl14-rpl12 intergenic region; n=1; Euglena longa|Rep: Uncharacterized 15.7 kDa protein in rpl14-rpl12 intergenic region - Astasia longa (Euglenophycean alga) Length = 125 Score = 36.3 bits (80), Expect = 0.64 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 2/64 (3%) Frame = -2 Query: 193 LLYIVDYV*VSKLIYRSFPF-AIIILTIDKASFFYALIENIDFFCIFPPFVMYSL-SLFM 20 ++YI+ + + K++Y+ FP+ IL IDK FF+ LI++I+F P + + F Sbjct: 42 IIYILKNLTLFKILYKCFPYIKNFILKIDKI-FFHVLIKSINFIKYIPQLIHDKIFEFFW 100 Query: 19 FLTK 8 F+ K Sbjct: 101 FILK 104 >UniRef50_O77393 Cluster: Putative uncharacterized protein MAL3P6.2; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL3P6.2 - Plasmodium falciparum (isolate 3D7) Length = 2423 Score = 34.7 bits (76), Expect = 1.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 480 IGNIVCSSSHPQDFERNHCNDIHEKNVC 397 +GN +S+H D +NHCND + KN C Sbjct: 129 VGNYDNNSNHSDDNNKNHCNDNNNKNHC 156 >UniRef50_Q8IJ33 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1196 Score = 32.7 bits (71), Expect = 7.8 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 183 MYNNMSFSKIVNSKKNVYFQNTLKFQSCVYY 275 +Y NM ++N KKN+Y N C YY Sbjct: 987 LYRNMKKYSLLNEKKNIYINNQFYLYLCKYY 1017 >UniRef50_Q7RT07 Cluster: Putative uncharacterized protein PY00194; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY00194 - Plasmodium yoelii yoelii Length = 1231 Score = 32.7 bits (71), Expect = 7.8 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = -2 Query: 598 NDDKGRRSC*KKFPRFLFGKMYDIARRLALTLGVSNRDKNREYCLFVITSSGL 440 N+DKG FP++ FG YD L+ + S + N Y + V T +GL Sbjct: 975 NNDKGHII--HAFPQYSFGNHYDNRNNLSKIIPTSEKGHNNGYPIIVDTKNGL 1025 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,442,116 Number of Sequences: 1657284 Number of extensions: 12083571 Number of successful extensions: 26265 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 25150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26255 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 48760335122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -