BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a06r (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44298| Best HMM Match : Herpes_US9 (HMM E-Value=8.9) 29 2.5 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 29 4.4 >SB_44298| Best HMM Match : Herpes_US9 (HMM E-Value=8.9) Length = 138 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/78 (23%), Positives = 37/78 (47%) Frame = +1 Query: 181 FHHSNNCR*HRYHYWQYRSRLRHNSSKCIPRQATYHHLQLIN*NHSISIEMYLLLCTDFI 360 +H N R HRYH+ + +HN + +HH Q + +H I + +++ + I Sbjct: 35 YHKLKNPR-HRYHHHHHH---QHNHHQHHHHHNHHHHHQQHHHHHHHIINIIVIIIVNII 90 Query: 361 CLYICFFKSGNVHVVVLS 414 + I N+ ++V++ Sbjct: 91 IIIIIIIIIINIIIIVIN 108 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 187 HSNNCR*HRYHYWQYRSRLRHNSSKCIPRQATYHHLQLIN*NHSISIEMYLLL 345 H + R H +H+ +Y R R+ + I Q HH +I N +I I M ++ Sbjct: 333 HRHRHRHHHHHHHEYNRRHRYFTDINITIQIIRHHFIIIIINITIIIMMITIM 385 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,436,186 Number of Sequences: 59808 Number of extensions: 461268 Number of successful extensions: 1116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -