BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a05r (662 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30690.1 68414.m03752 SEC14 cytosolic factor family protein /... 47 1e-05 At3g51670.1 68416.m05666 SEC14 cytosolic factor family protein /... 38 0.006 At1g72160.1 68414.m08343 SEC14 cytosolic factor family protein /... 35 0.042 At4g09160.1 68417.m01517 SEC14 cytosolic factor family protein /... 35 0.056 At1g22530.1 68414.m02814 SEC14 cytosolic factor family protein /... 35 0.056 At5g47510.1 68418.m05866 SEC14 cytosolic factor family protein /... 33 0.17 At1g55840.1 68414.m06404 SEC14 cytosolic factor (SEC14) / phosph... 33 0.17 At1g75170.1 68414.m08731 SEC14 cytosolic factor family protein /... 31 0.68 At1g09890.1 68414.m01113 expressed protein ; expression supporte... 31 0.90 At2g36690.1 68415.m04501 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 2.1 At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein /... 29 2.1 At5g64070.1 68418.m08046 phosphatidylinositol 4-kinase (PI4K) ne... 29 3.6 At4g37900.1 68417.m05360 glycine-rich protein 29 3.6 At3g10340.1 68416.m01240 phenylalanine ammonia-lyase, putative s... 28 4.8 At5g51670.1 68418.m06406 expressed protein contains Pfam domain ... 28 6.4 At5g22990.1 68418.m02687 zinc finger (C2H2 type) family protein ... 28 6.4 At3g48500.1 68416.m05294 expressed protein 27 8.4 At2g41770.1 68415.m05163 expressed protein contains Pfam domain ... 27 8.4 At2g19880.1 68415.m02324 ceramide glucosyltransferase, putative ... 27 8.4 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 27 8.4 >At1g30690.1 68414.m03752 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus; similar to cytosolic factor (Phosphatidylinositol/phosphatidylcholine transfer protein) (PI/PCTP) (SP:P24280) [Saccharomyces cerevisiae]; ESTs gb|T76582, gb|N06574 and gb|Z25700 come from this gene Length = 540 Score = 47.2 bits (107), Expect = 1e-05 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 4/104 (3%) Frame = -3 Query: 492 NAMVAGILSILDLDTVKIGHLLQMTPMF--LKKMVVASQDALPVRLKGTHYLNTPTGFET 319 N G+ S+L + +K + T ++ +KK++ QD P + ++N P F Sbjct: 319 NLKPGGVTSLLQIHDLKNAPGVSRTEIWVGIKKVIETLQDNYPEFVSRNIFINVPFWFYA 378 Query: 318 VFNAVKALLNEKNKKRLYVHN--QNYEEMYKYIPKDILPVEYGG 193 + + L ++ K + V + E + KYIP D LPV+YGG Sbjct: 379 MRAVLSPFLTQRTKSKFVVARPAKVRETLLKYIPADELPVQYGG 422 >At3g51670.1 68416.m05666 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to polyphosphoinositide binding protein Ssh2p (GI:2739046) {Glycine max};; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 409 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = -3 Query: 384 QDALPVRLKGTHYLNTPTGFETVFNAVKALLNEKNKKRLYVHNQNY--EEMYKYIPKDIL 211 QD P + ++N P F +++ L ++ K + + + E +YK+I + + Sbjct: 223 QDNYPELVATKIFINVPWYFSVIYSMFSPFLTQRTKSKFVMSKEGNAAETLYKFIRPEDI 282 Query: 210 PVEYGG 193 PV+YGG Sbjct: 283 PVQYGG 288 >At1g72160.1 68414.m08343 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to GI:807956 from [Saccharomyces cerevisiae]similar to polyphosphoinositide binding protein Ssh2p (GI:2739046) {Glycine max}; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 490 Score = 35.1 bits (77), Expect = 0.042 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = -3 Query: 405 KKMVVASQDALPVRLKGTHYLNTPTGFETVFNAVKALLNEKNKKRLYVH--NQNYEEMYK 232 K+ V QD P + ++N P + + + + ++K +L +++ E ++K Sbjct: 299 KQAVELLQDNYPEFVFKQAFINVPWWYLVFYTVIGPFMTPRSKSKLVFAGPSRSAETLFK 358 Query: 231 YIPKDILPVEYGG 193 YI + +PV+YGG Sbjct: 359 YISPEQVPVQYGG 371 >At4g09160.1 68417.m01517 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to polyphosphoinositide binding protein Ssh1p (GI:2739044) {Glycine max}; similar to polyphosphoinositide binding protein Ssh2, Glycine max, gb:T05953; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 668 Score = 34.7 bits (76), Expect = 0.056 Identities = 16/66 (24%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = -3 Query: 384 QDALPVRLKGTHYLNTPTGFETVFNAVKALLNEKNKKRLYVH--NQNYEEMYKYIPKDIL 211 QD P + ++N P + + + +++++K +L +++ E + KYI + + Sbjct: 481 QDNYPEFVSKQIFINVPWWYLAFYRIISPFMSQRSKSKLVFAGPSRSAETLLKYISPEHV 540 Query: 210 PVEYGG 193 PV+YGG Sbjct: 541 PVQYGG 546 >At1g22530.1 68414.m02814 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus; similar to SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (bTAP) (Fragment) (SP:P58875) {Bos taurus} Length = 683 Score = 34.7 bits (76), Expect = 0.056 Identities = 17/76 (22%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Frame = -3 Query: 411 FLKKMVVASQDALPVRLKGTHYLNTPTGFETVFNAVKALLNE---KNKKRLYVHNQNYEE 241 F+K+ V +D P + ++N P + + +++ ++K L +++ E Sbjct: 495 FIKRAVKQFEDNYPEFVAKELFINVPWWYIPYYKTFGSIITSPRTRSKMVLSGPSKSAET 554 Query: 240 MYKYIPKDILPVEYGG 193 ++KY+ +++PV+YGG Sbjct: 555 IFKYVAPEVVPVKYGG 570 >At5g47510.1 68418.m05866 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to phosphatidylinositol transfer-like protein IV (GI:14486707) [Lotus japonicus], SEC14 cytosolic factor (Phosphatidylinositol/phosphatidylcholine transfer protein) (PI/PCTP) (SP:P24859) [Kluyveromyces lactis] and to SEC14 cytosolic factor (SP:P53989) [Candida glabrata] Length = 376 Score = 33.1 bits (72), Expect = 0.17 Identities = 23/99 (23%), Positives = 43/99 (43%), Gaps = 1/99 (1%) Frame = -3 Query: 483 VAGILSILDLDTVKIGHLLQMTPMFLKKMVVASQDALPVRLKGTHYLNTPTGFETVFNAV 304 V+ +ILD+ V + + + ++ + P L +N +GF ++ A+ Sbjct: 163 VSSTTTILDVSGVGMSNFSKPARSLFMEIQKIDSNYYPETLHRLFVVNASSGFRMLWLAL 222 Query: 303 KALLNEKNKKRLYVHNQNY-EEMYKYIPKDILPVEYGGN 190 K L+ + ++ V NY E+ + I LP GGN Sbjct: 223 KTFLDARTLAKVQVLGPNYLGELLEAIEPSNLPTFLGGN 261 >At1g55840.1 68414.m06404 SEC14 cytosolic factor (SEC14) / phosphoglyceride transfer protein similar to polyphosphoinositide binding protein SEC14 homolog Ssh1p (GB:AAB94598) [Glycine max]; identified in Eur J Biochem 1998 Dec 1;258(2):402-10 as AtSEC14, characterized by functional complementation in S. cerevisiae. Length = 325 Score = 33.1 bits (72), Expect = 0.17 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 3/91 (3%) Frame = -3 Query: 471 LSILDLDTVKIGHLLQMTPMFLKKMVVASQDAL--PVRLKGTHYLNTPTGFETVFNAVKA 298 L ILD+ +K+ L Q+ M + + D L P + + + +N P F + +K Sbjct: 153 LKILDMSGLKLSALSQIKLM----TAITTIDDLNYPEKTETYYVVNVPYIFSACWKTIKP 208 Query: 297 LLNEKNKKRLYV-HNQNYEEMYKYIPKDILP 208 LL E+ KK++ V +E+ K + + LP Sbjct: 209 LLQERTKKKIQVLKGCGKDELLKIMDYESLP 239 >At1g75170.1 68414.m08731 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to polyphosphoinositide binding protein Ssh1p (GI:2739044) {Glycine max}; similar to SEC14 cytosolic factor (Phosphatidylinositol/phosphatidylcholine transfer protein) (PI/PCTP) (SP:P24859) [Kluyveromyces lactis] and to SEC14 cytosolic factor (SP:P53989) [Candida glabrata] Length = 296 Score = 31.1 bits (67), Expect = 0.68 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 4/95 (4%) Frame = -3 Query: 384 QDALPVRLKGTHYLNTPTGFETVFNAVKALLNEKNKKRL-YVHNQNYEE---MYKYIPKD 217 Q+ P RL N P FE + VK ++ K ++ +V+ +N E M + ++ Sbjct: 173 QNHYPERLAVAFLYNPPRLFEAFWKIVKYFIDAKTFVKVKFVYPKNSESVELMSTFFDEE 232 Query: 216 ILPVEYGGNGGSIEEIIDYWKKKVKEYSDWLEEDD 112 LP E+GG + ++ Y +E+S + +DD Sbjct: 233 NLPTEFGG-----KALLQY---NYEEFSKQMNQDD 259 >At1g09890.1 68414.m01113 expressed protein ; expression supported by MPSS Length = 633 Score = 30.7 bits (66), Expect = 0.90 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = -3 Query: 234 KYIPKDILPVEYGGNGGSIEEIIDYWKKKVKEYSDWLEEDDQ 109 +Y+ KD + G G ++ W+++ KEY W D++ Sbjct: 346 RYVDKDFIAANRGYVGLAVPGAAGSWQRECKEYQFWTRTDEE 387 >At2g36690.1 68415.m04501 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to IDS3 [Hordeum vulgare][GI:4514655], leucoanthocyanidin dioxygenase [SP|P51091][Malus domestica]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 366 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -3 Query: 249 YEEMYKYIPKDI-LPVEYGGNGGSIEEIIDYWKKKVKEYS 133 YEE KY+ D+ PV YG + I++ + W+ +K Y+ Sbjct: 118 YEERSKYMSSDMSAPVRYGTSFNQIKDNVFCWRDFLKLYA 157 >At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (bTAP) (Fragment) (SP:P58875) {Bos taurus}; similar to GI:807956 from [Saccharomyces cerevisiae]; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 573 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/76 (21%), Positives = 38/76 (50%), Gaps = 3/76 (3%) Frame = -3 Query: 411 FLKKMVVASQDALPVRLKGTHYLNTPTGFETVFNAVKALLNE---KNKKRLYVHNQNYEE 241 F+++ V +D P ++N P + + +++ ++K L +++ + Sbjct: 387 FIRRAVKQFEDNYPEFAAKELFINVPWWYIPYYKTFGSIITSPRTRSKMVLAGPSKSADT 446 Query: 240 MYKYIPKDILPVEYGG 193 ++KYI + +PV+YGG Sbjct: 447 IFKYIAPEQVPVKYGG 462 >At5g64070.1 68418.m08046 phosphatidylinositol 4-kinase (PI4K) nearly identical to gi:4467359 Length = 1121 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 7/71 (9%) Frame = -3 Query: 249 YEEMYKYIPKDILPVEYGGNG--GSIEE---IIDYWKKKVKEYSDWLEEDDQYGTDE--S 91 ++ +++ P+D P N G +E ++++K ++ +E+ + +G+ + Sbjct: 460 FKRLFRIHPEDAKPTSENENSSNGLVESSPGTENFFRKLFRDRDQSVEDSELFGSKKHKE 519 Query: 90 KRPGKPKTAED 58 KRPG PK +D Sbjct: 520 KRPGSPKQRDD 530 >At4g37900.1 68417.m05360 glycine-rich protein Length = 787 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 366 ELVMRPEKQPPFFSRTLESFVINDLFLQ 449 +LV+ ++Q PFF + + V ND+FLQ Sbjct: 164 DLVLAVKRQSPFFYQVSRAHVDNDVFLQ 191 >At3g10340.1 68416.m01240 phenylalanine ammonia-lyase, putative similar to phenylalanine ammonia-lyase GB:S48726 [Petroselinum crispum] Length = 707 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 195 GNGGSIEEIIDYWKKKVKEYSDWLEEDDQYGTD 97 G GGS E+ + + VK S+W+ E GTD Sbjct: 65 GGGGSTVELAEEARAGVKASSEWVMESMNRGTD 97 >At5g51670.1 68418.m06406 expressed protein contains Pfam domain PF05003: protein of unknown function (DUF668) Length = 474 Score = 27.9 bits (59), Expect = 6.4 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 Query: 281 IRNASTSTTRIMKRCTNISLRTFYQ 207 + +A+ S +R+ RCT SLR+F++ Sbjct: 99 LAHAANSVSRLSNRCTTASLRSFHR 123 >At5g22990.1 68418.m02687 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 324 Score = 27.9 bits (59), Expect = 6.4 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 291 NEKNKKRLYVHNQN-YEEMYKYIPKDILPVEYGGN 190 N +NKKRL NQ +EE P++I+ E GG+ Sbjct: 283 NARNKKRLRKRNQMIHEESNNIQPEEIVAEESGGD 317 >At3g48500.1 68416.m05294 expressed protein Length = 668 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/53 (24%), Positives = 30/53 (56%), Gaps = 7/53 (13%) Frame = -3 Query: 195 GNGGSIEEI-IDYWKKKVKEYSDWLE------EDDQYGTDESKRPGKPKTAED 58 G +++++ ++ +K +K+Y +W+E E++ Y D+ PG+ K +D Sbjct: 206 GEDATVDKMCLERFKVFLKQYKEWVEDNKDRLEEESYKLDQDFYPGRRKRGKD 258 >At2g41770.1 68415.m05163 expressed protein contains Pfam domain PF03385: Protein of unknown function, DUF288 Length = 771 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 318 VFNAVKALLNEKNKKRLYVHNQNYEEMYKYIPK 220 +F V L ++KN LYV + +YK++PK Sbjct: 544 IFKTVVILSSQKNSD-LYVEEAKLDHIYKHLPK 575 >At2g19880.1 68415.m02324 ceramide glucosyltransferase, putative similar to ceramide glucosyltransferase (GI:14718995) [Gossypium arboreum]; weak similarity to Ceramide glucosyltransferase (Glucosylceramide synthase) (GCS) (UDP-glucose:N-acylsphingosine D-glucosyltransferase) (GLCT-1) (Swiss-Prot:Q16739) [Homo sapiens] Length = 519 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -1 Query: 647 WGQYWYYLRLQLLIL--HVSV*SYLADMMLISTIFPMSWLYL*SY 519 +G+YW YLR Q +L ++S +++ + L + +SW ++ Y Sbjct: 307 FGRYWNYLRKQTFVLESYISKVNWIMNKALFAVHCYLSWGFVAPY 351 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 27.5 bits (58), Expect = 8.4 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -3 Query: 372 PVRLKGTHYLNTPTGFETVFNA--VKALLNEKNKKRLYVHNQNYEEMYKYI 226 PV G HYLN+P G +T F V L E + L H + Y E+ + + Sbjct: 5 PVPGSGFHYLNSPFG-DTTFTKVFVGGLAWETQSETLRQHFEQYGEILEAV 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,953,619 Number of Sequences: 28952 Number of extensions: 333156 Number of successful extensions: 1067 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1065 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -