BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a05f (580 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 31 0.005 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 23 2.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 4.3 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 5.7 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 31.5 bits (68), Expect = 0.005 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 29 KTSMTMSVRALPPELAEKARKELNEDPSRINSDIQHLKDW 148 K +S RA P +A + ++LN + +I D++ LK W Sbjct: 272 KLDSLVSSRAWPSRVANQKLRDLNREVDQIKQDVEDLKRW 311 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 25 VENVDDHVCSSVTSGVS 75 VENV+D S +T+GV+ Sbjct: 121 VENVEDLFTSGITTGVN 137 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 4.3 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 306 AIHYLMKY*VWGQYWYYLRLQLLILHVSV*SYLADMMLISTI 431 AI L + + G + + LI+HVS +Y+A + + S I Sbjct: 419 AIFVLCELLIEGTTSILINVPSLIIHVSTSAYVATVWINSVI 460 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +1 Query: 31 NVDDHVCSSVTSGVSRKS 84 N D+ C+ ++S VSR + Sbjct: 35 NTDEETCTRISSTVSRNT 52 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,483 Number of Sequences: 336 Number of extensions: 2991 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -