BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a03f (602 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) 344 3e-95 SB_57373| Best HMM Match : DUF292 (HMM E-Value=4.7) 29 2.9 SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) 29 2.9 SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) 29 2.9 SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_55109| Best HMM Match : fn3 (HMM E-Value=0.017) 27 8.8 SB_52203| Best HMM Match : Borrelia_orfA (HMM E-Value=1.7) 27 8.8 SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_42599| Best HMM Match : DUF536 (HMM E-Value=7.2) 27 8.8 SB_15903| Best HMM Match : Gate (HMM E-Value=6) 27 8.8 >SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) Length = 240 Score = 344 bits (846), Expect = 3e-95 Identities = 168/187 (89%), Positives = 177/187 (94%) Frame = +3 Query: 42 ISKKRKFVGDGVFKAELNEFLTRELAEDGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGR 221 ISKKRKFV DG+FKAELNEFLTRELAEDGYSGVEVRVTPIR+EIII+ATRTQ+VLGEKGR Sbjct: 5 ISKKRKFVADGLFKAELNEFLTRELAEDGYSGVEVRVTPIRTEIIILATRTQNVLGEKGR 64 Query: 222 RIRELTSVVQKRFNIPEQSVELYAEKVATRGLCAIAQAESLRYKLIGGLAVRRACYGVLR 401 RIRELTSVVQKRF PE SVELYAEKVATRGLCAIAQ ESLRYKLIGGLAVRRACYGVLR Sbjct: 65 RIRELTSVVQKRFGFPEGSVELYAEKVATRGLCAIAQCESLRYKLIGGLAVRRACYGVLR 124 Query: 402 FIMESGARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVNTATRHVLLRQGVLGI 581 FIMESGA+GCEVVVSGKLRGQRAKSMKFVDGLM+H+G+P YV+TA RHV LRQGVLGI Sbjct: 125 FIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMVHAGEPTTHYVDTAVRHVYLRQGVLGI 184 Query: 582 KVKIMLP 602 KVKIMLP Sbjct: 185 KVKIMLP 191 >SB_57373| Best HMM Match : DUF292 (HMM E-Value=4.7) Length = 383 Score = 29.1 bits (62), Expect = 2.9 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 6/72 (8%) Frame = +3 Query: 96 EFLTRELAEDGYSGVEVR--VTPIR----SEIIIMATRTQSVLGEKGRRIRELTSVVQKR 257 E+L R++ D YS E +TP +IMA R QSVL ++GR +LT Q+R Sbjct: 175 EYLQRKI-NDAYSPEEAEKNITPYSLCSYENPMIMAFRLQSVLRKRGR--DDLT-WAQQR 230 Query: 258 FNIPEQSVELYA 293 F+ SVE +A Sbjct: 231 FDDLADSVEQFA 242 >SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3172 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/70 (22%), Positives = 34/70 (48%) Frame = +3 Query: 126 GYSGVEVRVTPIRSEIIIMATRTQSVLGEKGRRIRELTSVVQKRFNIPEQSVELYAEKVA 305 GY+ + + S +++ A +++ ++ + +RE +QKRF E+ +Y Sbjct: 1941 GYTARKEYSRCVTSIVLMQALVRRNLAVKRYQALREAAIGIQKRFRAKEEGKLVYLMFHI 2000 Query: 306 TRGLCAIAQA 335 RG C + Q+ Sbjct: 2001 QRGACIVIQS 2010 >SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) Length = 401 Score = 29.1 bits (62), Expect = 2.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 446 WQAAWSTCQINEVCRWTHDPLW 511 W+ AW+ C + E +T++P W Sbjct: 76 WKQAWTPCSLQETTIYTNNPPW 97 >SB_51602| Best HMM Match : Glyco_hydro_38C (HMM E-Value=1.1e-31) Length = 976 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 Query: 440 CIWQAAWSTCQINEVCRWTHDPLWRP 517 C W + W + E WTH P RP Sbjct: 185 CRWLSQWKQSEEEESVLWTHSPARRP 210 >SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +2 Query: 305 YSWSLRYRPGRISKIQAYRRSRCTSCLLWCSPFHHGIWRPW 427 Y+W L + P + ++ Y R + L C+P + W W Sbjct: 4 YNWWLAWNPALLCLMRQYNRWLAWNPALLCNPRQYNRWLAW 44 >SB_55109| Best HMM Match : fn3 (HMM E-Value=0.017) Length = 339 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 459 GQRAKSMKFVDGLMIHSGDPCNDYVNTATRHVLLRQGVLGIKVKI 593 G++ ++ IH G P DY + L R+GV G+ V I Sbjct: 25 GKKTAGRLRLERTQIHGGSPVIDYKVEVDQVKLAREGVTGVPVVI 69 >SB_52203| Best HMM Match : Borrelia_orfA (HMM E-Value=1.7) Length = 611 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +2 Query: 302 GYSWSLRYRPGRISKIQAYRRSRCTSCLLWCSP 400 GY+++LRY+P ++ R++R + +LW +P Sbjct: 363 GYNYTLRYKPNTVTN----RKTRKRNNILWYNP 391 >SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 623 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 240 SVVQKRFNIPEQSVELYAEKVATRGLCAI 326 +++ + F P E +A K+ TRGLC I Sbjct: 402 NILHRHFGYPVTFQEFFAIKLITRGLCRI 430 >SB_42599| Best HMM Match : DUF536 (HMM E-Value=7.2) Length = 120 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +3 Query: 87 ELNEFLTRELAE-DGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGRRIRELTSVVQKRFN 263 E+ E + + +AE +G SG EV+ ++ + ++ +TQ E ++ +EL + +KR N Sbjct: 20 EVIEVVNKLIAEGEGESGNEVKENKVKKKPSVIK-QTQ----EDEKKTKELEELKEKRIN 74 Query: 264 IPE 272 +P+ Sbjct: 75 LPQ 77 >SB_15903| Best HMM Match : Gate (HMM E-Value=6) Length = 444 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 302 GYSWSLRYRPGRISKIQAYRRSRCTSCLLW 391 G +W +R P + + +A+R +R SC LW Sbjct: 88 GKNWKVRASPAWVRRYRAFRHAR--SCSLW 115 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,624,744 Number of Sequences: 59808 Number of extensions: 415694 Number of successful extensions: 1192 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1188 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -