BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a02r (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.9 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 23 3.8 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 23 3.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 6.7 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 2.9 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +2 Query: 557 YFLNYQFEKFVNCLYIVKSTVFHSHCQFQKXSFS-FTTQYKVTCLSPAKRLTQ 712 YFLN E + V+ H C++ S + + Y C S KRLT+ Sbjct: 411 YFLNLTVENNRRNPWFVEFWEHHFQCRYPNASVTPYNKNYTKFC-STEKRLTK 462 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 496 CISAVES*RCNKVYGATLCV 437 C+ S CNK+Y CV Sbjct: 114 CLPTSGSDNCNKIYNLAKCV 133 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 496 CISAVES*RCNKVYGATLCV 437 C+ S CNK+Y CV Sbjct: 114 CLPTSGSDNCNKIYNLAKCV 133 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 72 YNTVDFNNYEVSSYFFNSI 128 YN ++NNY Y+ N I Sbjct: 333 YNNNNYNNYNKKLYYKNYI 351 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,320 Number of Sequences: 438 Number of extensions: 2963 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -