BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a02r (720 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58660.1 68418.m07350 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 3.1 At1g13870.1 68414.m01628 expressed protein similar to KTI12 prot... 28 7.2 >At5g58660.1 68418.m07350 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to ACC oxidase, Lycopersicon esculentum [SP|P05116], gibberellin 3B-hydroxylase, Latuca sativa [gi:4164145]; contains Pfam domain PF03171, 2OG-Fe(II) oxygenase superfamily Length = 352 Score = 29.1 bits (62), Expect = 3.1 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 434 RDAERRSV-HFVTPLRLDCTYTLRNLTLFTYNKF 532 R ER SV +FV P R DC N LFTY+ F Sbjct: 292 RKTERHSVCYFVFPKR-DCVIKSSNYKLFTYSDF 324 >At1g13870.1 68414.m01628 expressed protein similar to KTI12 protein (SP:P34253) {Saccharomyces cerevisiae}; contains Prosite PS00070: Aldehyde dehydrogenases cysteine active site Length = 302 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -1 Query: 711 CVSRLAGLRHVTLYCVVNE 655 C++R AG+R+ +YC V+E Sbjct: 94 CIARAAGIRYCVVYCDVDE 112 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,187,383 Number of Sequences: 28952 Number of extensions: 174506 Number of successful extensions: 277 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 277 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -