BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a01f (596 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC040168-1|AAH40168.1| 479|Homo sapiens v-ets erythroblastosis ... 34 0.44 AL445686-3|CAI14683.1| 913|Homo sapiens serine/arginine repetit... 32 1.8 AL445648-2|CAH73089.1| 913|Homo sapiens serine/arginine repetit... 32 1.8 BC036187-1|AAH36187.1| 904|Homo sapiens serine/arginine repetit... 31 4.1 AL445686-4|CAI14682.1| 904|Homo sapiens serine/arginine repetit... 31 4.1 AL445648-3|CAH73090.1| 904|Homo sapiens serine/arginine repetit... 31 4.1 AY605045-1|AAT35812.1| 199|Homo sapiens HCV F-transactivated pr... 30 5.4 DQ328220-1|ABC59627.1| 178|Homo sapiens actin related protein 2... 30 7.2 CR407667-1|CAG28595.1| 178|Homo sapiens ARPC3 protein. 30 7.2 BC078162-1|AAH78162.1| 178|Homo sapiens actin related protein 2... 30 7.2 BC067747-1|AAH67747.1| 178|Homo sapiens actin related protein 2... 30 7.2 AF006086-1|AAB64191.1| 178|Homo sapiens p21-Arc protein. 30 7.2 >BC040168-1|AAH40168.1| 479|Homo sapiens v-ets erythroblastosis virus E26 oncogene homolog (avian) protein. Length = 479 Score = 33.9 bits (74), Expect = 0.44 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 3/105 (2%) Frame = -1 Query: 560 SSFVFQ--LVHPRCSQGRLVNRRPQLEHRRCLRS*QNQPGHRRPQLEHRRCLRSLQNQPG 387 ++F+F V+P +Q + RP L + RS GH PQ + + S + Sbjct: 227 AAFIFPNTSVYPEATQR--ITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTE 284 Query: 386 HRRPQLEHRGFLRSLQSQPGNRHS-QLELRHFLRSLQNQQGNRRC 255 +RPQL+ L S+ N S Q++L FL L + N C Sbjct: 285 DQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSC 329 >AL445686-3|CAI14683.1| 913|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 913 Score = 31.9 bits (69), Expect = 1.8 Identities = 21/69 (30%), Positives = 30/69 (43%) Frame = -1 Query: 470 RS*QNQPGHRRPQLEHRRCLRSLQNQPGHRRPQLEHRGFLRSLQSQPGNRHSQLELRHFL 291 R+ P H RP+ HR RS + RRP R R + P +R S+ +R Sbjct: 287 RTRSRSPSHTRPRRRHRS--RSRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRR 344 Query: 290 RSLQNQQGN 264 RS + G+ Sbjct: 345 RSSASLSGS 353 >AL445648-2|CAH73089.1| 913|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 913 Score = 31.9 bits (69), Expect = 1.8 Identities = 21/69 (30%), Positives = 30/69 (43%) Frame = -1 Query: 470 RS*QNQPGHRRPQLEHRRCLRSLQNQPGHRRPQLEHRGFLRSLQSQPGNRHSQLELRHFL 291 R+ P H RP+ HR RS + RRP R R + P +R S+ +R Sbjct: 287 RTRSRSPSHTRPRRRHRS--RSRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRR 344 Query: 290 RSLQNQQGN 264 RS + G+ Sbjct: 345 RSSASLSGS 353 >BC036187-1|AAH36187.1| 904|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 904 Score = 30.7 bits (66), Expect = 4.1 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = -1 Query: 470 RS*QNQPGHRRPQLEHRRCLRSL--QNQPG-HRRPQLEHRGFLRSLQSQPGNRHSQLELR 300 R+ P H RP+ HR RS + +P RRP R R + P +R S+ +R Sbjct: 287 RTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVR 346 Query: 299 HFLRSLQNQQGN 264 RS + G+ Sbjct: 347 RRRRSSASLSGS 358 >AL445686-4|CAI14682.1| 904|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 904 Score = 30.7 bits (66), Expect = 4.1 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = -1 Query: 470 RS*QNQPGHRRPQLEHRRCLRSL--QNQPG-HRRPQLEHRGFLRSLQSQPGNRHSQLELR 300 R+ P H RP+ HR RS + +P RRP R R + P +R S+ +R Sbjct: 287 RTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVR 346 Query: 299 HFLRSLQNQQGN 264 RS + G+ Sbjct: 347 RRRRSSASLSGS 358 >AL445648-3|CAH73090.1| 904|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 904 Score = 30.7 bits (66), Expect = 4.1 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = -1 Query: 470 RS*QNQPGHRRPQLEHRRCLRSL--QNQPG-HRRPQLEHRGFLRSLQSQPGNRHSQLELR 300 R+ P H RP+ HR RS + +P RRP R R + P +R S+ +R Sbjct: 287 RTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVR 346 Query: 299 HFLRSLQNQQGN 264 RS + G+ Sbjct: 347 RRRRSSASLSGS 358 >AY605045-1|AAT35812.1| 199|Homo sapiens HCV F-transactivated protein 1 protein. Length = 199 Score = 30.3 bits (65), Expect = 5.4 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = -1 Query: 290 RSLQNQQGNRRCQREFQCQKSQ---RCLHFRSIQSRPRR 183 R LQN +GN RCQR+ + ++ CL I PRR Sbjct: 12 RPLQNVEGNNRCQRKAKNYGNKYFIHCLDLEKITLSPRR 50 >DQ328220-1|ABC59627.1| 178|Homo sapiens actin related protein 2/3 complex protein. Length = 178 Score = 29.9 bits (64), Expect = 7.2 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -1 Query: 359 GF-LRSLQSQPGNRHSQLELRHFLRSLQNQQGNRRCQREFQCQKSQ 225 GF L ++ ++P N+ +R +L+ L+ + G R C++ F Q + Sbjct: 110 GFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDK 155 >CR407667-1|CAG28595.1| 178|Homo sapiens ARPC3 protein. Length = 178 Score = 29.9 bits (64), Expect = 7.2 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -1 Query: 359 GF-LRSLQSQPGNRHSQLELRHFLRSLQNQQGNRRCQREFQCQKSQ 225 GF L ++ ++P N+ +R +L+ L+ + G R C++ F Q + Sbjct: 110 GFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDK 155 >BC078162-1|AAH78162.1| 178|Homo sapiens actin related protein 2/3 complex, subunit 3, 21kDa protein. Length = 178 Score = 29.9 bits (64), Expect = 7.2 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -1 Query: 359 GF-LRSLQSQPGNRHSQLELRHFLRSLQNQQGNRRCQREFQCQKSQ 225 GF L ++ ++P N+ +R +L+ L+ + G R C++ F Q + Sbjct: 110 GFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDK 155 >BC067747-1|AAH67747.1| 178|Homo sapiens actin related protein 2/3 complex, subunit 3, 21kDa protein. Length = 178 Score = 29.9 bits (64), Expect = 7.2 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -1 Query: 359 GF-LRSLQSQPGNRHSQLELRHFLRSLQNQQGNRRCQREFQCQKSQ 225 GF L ++ ++P N+ +R +L+ L+ + G R C++ F Q + Sbjct: 110 GFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDK 155 >AF006086-1|AAB64191.1| 178|Homo sapiens p21-Arc protein. Length = 178 Score = 29.9 bits (64), Expect = 7.2 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -1 Query: 359 GF-LRSLQSQPGNRHSQLELRHFLRSLQNQQGNRRCQREFQCQKSQ 225 GF L ++ ++P N+ +R +L+ L+ + G R C++ F Q + Sbjct: 110 GFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDK 155 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,046,851 Number of Sequences: 237096 Number of extensions: 1597508 Number of successful extensions: 4270 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4240 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -