BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10p23r (678 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 24 5.1 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 24 5.1 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 24 5.1 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 6.7 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 23 8.9 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 23 8.9 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 23 8.9 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.8 bits (49), Expect = 5.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 286 NAASLSIGCSGLCLPEL*RHCTNQST 209 + A L I CS +P HC++ ST Sbjct: 445 SVAKLPISCSSNSIPPPSNHCSSPST 470 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 23.8 bits (49), Expect = 5.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 513 IQCLLSQKESPSESRDI 463 + CLLS+K P E +D+ Sbjct: 51 VDCLLSRKPCPPEGKDL 67 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 23.8 bits (49), Expect = 5.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 513 IQCLLSQKESPSESRDI 463 + CLLS+K P E +D+ Sbjct: 51 VDCLLSRKPCPPEGKDL 67 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 6.7 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 534 GNGSCCCIQCLLSQKESPSESRD 466 G G C C C+ ++ +P E D Sbjct: 562 GRGQCVCGVCVCERRPNPDELID 584 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +1 Query: 523 GAVPNKPTR*INTSKNKANDTSPYTWNLTSP 615 G +P K + +D+ PY W L P Sbjct: 88 GCIPKKLMHQASLLGEAIHDSQPYGWQLPDP 118 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +1 Query: 523 GAVPNKPTR*INTSKNKANDTSPYTWNLTSP 615 G +P K + +D+ PY W L P Sbjct: 64 GCIPKKLMHQASLLGEAIHDSQPYGWQLPDP 94 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +1 Query: 523 GAVPNKPTR*INTSKNKANDTSPYTWNLTSP 615 G +P K + +D+ PY W L P Sbjct: 61 GCIPKKLMHQASLLGEAIHDSQPYGWQLPDP 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,700 Number of Sequences: 2352 Number of extensions: 15541 Number of successful extensions: 34 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -