BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10p13r (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 23 2.0 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 23 2.6 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 23 2.6 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 23 2.6 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 4.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 4.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.6 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 23.4 bits (48), Expect = 2.0 Identities = 20/81 (24%), Positives = 34/81 (41%), Gaps = 5/81 (6%) Frame = -2 Query: 391 FNYALLGNQENANTVLQFVKNNIAA---IRTAYIEDAPPTPVHT--ALSNLAAYLDESGL 227 + Y L G++ N T+L +K + T + P + A+SN+ ++ Sbjct: 142 WEYPLEGDRANFITLLSDLKEAFRPGGYLLTVAVAAIPTDAAYDVPAMSNVLDVINVMTY 201 Query: 226 DEYETWLRSTQTNIPQYNSAL 164 D + +W T N P Y S L Sbjct: 202 DFHGSWAGVTAQNSPLYASPL 222 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +2 Query: 293 VFNVCRSYSSNIVLHELENRVSV 361 ++++ R Y +N++L ELE +V Sbjct: 105 IYSISRDYLNNVLLTELEKYPNV 127 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +2 Query: 293 VFNVCRSYSSNIVLHELENRVSV 361 ++++ R Y +N++L ELE +V Sbjct: 105 IYSISRDYLNNVLLTELEKYPNV 127 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +2 Query: 293 VFNVCRSYSSNIVLHELENRVSV 361 ++++ R Y +N++L ELE +V Sbjct: 105 IYSISRDYLNNVLLTELEKYPNV 127 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 652 ILGCTLCVQGC 684 ++GC LC GC Sbjct: 220 VIGCVLCSPGC 230 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 652 ILGCTLCVQGC 684 ++GC LC GC Sbjct: 534 VIGCVLCSPGC 544 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 652 ILGCTLCVQGC 684 ++GC LC GC Sbjct: 794 VIGCVLCSPGC 804 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 652 ILGCTLCVQGC 684 ++GC LC GC Sbjct: 794 VIGCVLCSPGC 804 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 652 ILGCTLCVQGC 684 ++GC LC GC Sbjct: 767 VIGCVLCSPGC 777 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 652 ILGCTLCVQGC 684 ++GC LC GC Sbjct: 767 VIGCVLCSPGC 777 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 652 ILGCTLCVQGC 684 ++GC LC GC Sbjct: 794 VIGCVLCSPGC 804 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 652 ILGCTLCVQGC 684 ++GC LC GC Sbjct: 794 VIGCVLCSPGC 804 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,585 Number of Sequences: 336 Number of extensions: 3048 Number of successful extensions: 20 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -