BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10p11r (302 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 25 0.83 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 1.1 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 1.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 22 4.4 AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 22 4.4 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 22 5.9 AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 21 7.8 AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like pepti... 21 7.8 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.6 bits (51), Expect = 0.83 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -2 Query: 136 RAEALKRDESHVRVTPWANGRPAHLQKAVPK*RR 35 R+ +R R T W RP K +P+ RR Sbjct: 272 RSPPARRRSRSTRPTSWPRSRPTSKPKRLPRRRR 305 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +1 Query: 178 CLSSLCKLNQLASKRSFCYCSC 243 C+ ++C LN+L R + + +C Sbjct: 651 CMGAVCNLNELIQGRRYFFRAC 672 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 1.1 Identities = 17/75 (22%), Positives = 32/75 (42%) Frame = -1 Query: 269 QFIFENKSKQEQ*QNERLEASWFNLHKLLKHRSQGASQVTKARISSRGVET*RISRQSHT 90 Q+ + + +Q+Q Q ++ + H+L H SQ + SS G T I + + Sbjct: 1303 QYQQQLQQQQQQQQQQQQQHQQHQQHQLQHHHQPQLSQSSHHSSSSHGGPTPSIISHTPS 1362 Query: 89 LGQRTTCTPPESCSK 45 L + P+S + Sbjct: 1363 LSSASGSIGPKSADQ 1377 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 250 KVNKNNNKMSAWRQA 206 K N NNNKMSA A Sbjct: 1662 KWNSNNNKMSATSMA 1676 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +3 Query: 54 AFWRCAGRPLAQGVTLT*DSSRFNASARNSCFSDLRSTLAAM 179 A+W AG+P+ QG + DS A+ N + R+ M Sbjct: 71 AYWADAGKPVQQGDSP--DSQNAYANCANEPYCAARTVQGYM 110 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 86 GQRTTCTPPESCSKVKK 36 G TC P ++CS V+K Sbjct: 36 GTAGTCEPVKNCSYVRK 52 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/40 (22%), Positives = 20/40 (50%) Frame = +1 Query: 172 LRCLSSLCKLNQLASKRSFCYCSCLLLFSKIN*NFPDFHS 291 L+ L L + +++ + +C + + S + FPD H+ Sbjct: 15 LQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLHT 54 >AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like peptide 3 precursor protein. Length = 160 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/40 (22%), Positives = 20/40 (50%) Frame = +1 Query: 172 LRCLSSLCKLNQLASKRSFCYCSCLLLFSKIN*NFPDFHS 291 L+ L L + +++ + +C + + S + FPD H+ Sbjct: 15 LQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLHT 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 311,941 Number of Sequences: 2352 Number of extensions: 5615 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19557855 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -