BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10p11r (302 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 4.4 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 4.4 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 20 5.8 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 20 5.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 20 5.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 20 5.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 20 5.8 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 20 7.7 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 20 7.7 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 20 7.7 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.6 bits (41), Expect = 4.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 221 AHFVIVLVYFYSQK*IEIFLI 283 A + ++LVYF+ Q+ + FLI Sbjct: 198 AEYSMLLVYFHLQRHMGNFLI 218 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 20.6 bits (41), Expect = 4.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -1 Query: 299 TLWLWKSGKFQFIFENKSKQEQ*QNER 219 T W + G+ QF F KQ+ N R Sbjct: 178 TGWTFHEGRKQFYFHQFYKQQPDLNYR 204 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 5.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 250 KVNKNNNKMSAWRQAGLTYINYSN 179 K+ NNN +S Y NY+N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNN 103 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 5.8 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 253 IKVNKNNNKMSAWRQAGLTY 194 + VNK+ NK + W++ Y Sbjct: 690 VSVNKSWNKWNDWQETQNNY 709 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 5.8 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 253 IKVNKNNNKMSAWRQAGLTY 194 + VNK+ NK + W++ Y Sbjct: 690 VSVNKSWNKWNDWQETQNNY 709 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 5.8 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 253 IKVNKNNNKMSAWRQAGLTY 194 + VNK+ NK + W++ Y Sbjct: 690 VSVNKSWNKWNDWQETQNNY 709 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.2 bits (40), Expect = 5.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 32 IPSSLWNSFLEVCRS 76 I SL FL+VCRS Sbjct: 334 IRESLDTQFLQVCRS 348 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 19.8 bits (39), Expect = 7.7 Identities = 6/20 (30%), Positives = 10/20 (50%) Frame = +2 Query: 2 LMIFMHGWLTIPSSLWNSFL 61 + +F GW P WN ++ Sbjct: 175 IWLFSLGWTIAPMFGWNRYV 194 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 19.8 bits (39), Expect = 7.7 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 6/50 (12%) Frame = +1 Query: 106 EIRHVSTPLLEIL-ALVTCE-----APWLRCLSSLCKLNQLASKRSFCYC 237 E+ + PLL + VTC+ + WL S C + LA +R C Sbjct: 46 ELMDSNEPLLPLRHRRVTCDVLSWQSKWLSINHSACAIRCLAQRRKGGSC 95 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 19.8 bits (39), Expect = 7.7 Identities = 6/20 (30%), Positives = 10/20 (50%) Frame = +2 Query: 2 LMIFMHGWLTIPSSLWNSFL 61 + +F GW P WN ++ Sbjct: 51 IWLFSLGWTIAPMFGWNRYV 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,272 Number of Sequences: 438 Number of extensions: 1344 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6368931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -