BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10p05f (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40143| Best HMM Match : 7tm_1 (HMM E-Value=2.8e-09) 28 5.7 >SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1488 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = -2 Query: 149 LKTRALLVELGSATSLVDTATTAVNTNKRANFILQNRSELKFRLKS 12 L TRA +V L +T+++ ATT V +K + ++ ELK +++S Sbjct: 625 LATRAPIVSLSKSTNIISKATTFVAVDKSTHEVIA-VPELKAQVES 669 >SB_40143| Best HMM Match : 7tm_1 (HMM E-Value=2.8e-09) Length = 334 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 185 RNSLSFEAIVPMLKTRALLVELGSATSLVDTATTAVNTNKRANFILQN 42 +N F+A +P L L +G+ SLV T +R+N++L N Sbjct: 15 KNEGVFKAAIPCLTVLGLWAIIGNTISLVVLLKTKSLRRRRSNYLLVN 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,440,761 Number of Sequences: 59808 Number of extensions: 397109 Number of successful extensions: 879 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -