BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10p03r (753 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 27 2.9 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 26 6.6 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 27.1 bits (57), Expect = 2.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -3 Query: 496 VTTSNVQMHGSYNMDTLHNDVAIINHNHVGFTNNIQRINLASGSN 362 VT SNV + YN+ + + +N++ V + N I+ S SN Sbjct: 157 VTNSNVTIEHFYNVKGNVDSLFFLNNDSVAISGNFTEISPFSSSN 201 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 25.8 bits (54), Expect = 6.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 687 ALAAEPPTILVPSXSAAS 740 A A EPPT+ VPS SA S Sbjct: 1030 ASAYEPPTVSVPSPSALS 1047 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,649,381 Number of Sequences: 5004 Number of extensions: 45625 Number of successful extensions: 171 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 359287726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -