BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10o21f (662 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 24 1.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.0 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 3.4 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 7.9 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 7.9 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 24.2 bits (50), Expect = 1.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 515 NSFRSYTTGHYPAHRHTRLFHIR 583 N +++ HY +H+H R H+R Sbjct: 113 NQYKNQNNNHYTSHQHLRT-HLR 134 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = +3 Query: 417 NFSSEDGDRTAPHEWDISRVLWQARW 494 + S + G EW+ R LW W Sbjct: 560 SISVDSGSINTVAEWEPPRALWPTEW 585 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = +3 Query: 78 IFWTKMPRRGVHTESGPSTTADVIMLNDRNVATVSG 185 ++W + P RGV P T NDR +G Sbjct: 191 MYWKETPVRGVEEAELPQFTIIGYETNDRKEKLATG 226 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 177 VSGDVASIQTSQFNATEGPRDVETN 251 + G A I+ S NAT+GP V N Sbjct: 40 LGGYDARIRPSGENATDGPAVVRVN 64 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 177 VSGDVASIQTSQFNATEGPRDVETN 251 + G A I+ S NAT+GP V N Sbjct: 40 LGGYDARIRPSGENATDGPAIVRVN 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,381 Number of Sequences: 438 Number of extensions: 4142 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -