BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10o14r (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 3.6 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 3.6 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 6.3 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 23 6.3 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 374 FRLSRESNEHRTYWSHQGFF 315 +RL ES E + W GFF Sbjct: 46 YRLEGESREWKALWIRDGFF 65 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 374 FRLSRESNEHRTYWSHQGFF 315 +RL ES E + W GFF Sbjct: 46 YRLEGESREWKALWIRDGFF 65 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +2 Query: 254 KMNLIVVEVDDEINIYNELRQRTPDATSRSDVHYFHAIIEIEL 382 ++++IVV D+++++ L + T DA + +EIEL Sbjct: 267 QLSMIVVLPDEQVSLGQLLSRLTADAVHETLADMSEEEVEIEL 309 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 488 WQNERLSKRGSFRRSVGALLR 426 W+ E LSK +F R V +L+ Sbjct: 426 WRREFLSKNATFSRPVSVVLK 446 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 623,510 Number of Sequences: 2352 Number of extensions: 11402 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -