BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10o14f (637 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83127-5|CAB05628.2| 575|Caenorhabditis elegans Hypothetical pr... 30 1.6 AL032657-8|CAB63370.1| 389|Caenorhabditis elegans Hypothetical ... 28 6.4 Z81560-4|CAB04546.1| 94|Caenorhabditis elegans Hypothetical pr... 27 8.5 U40959-2|AAA81766.1| 413|Caenorhabditis elegans Hypothetical pr... 27 8.5 >Z83127-5|CAB05628.2| 575|Caenorhabditis elegans Hypothetical protein T23F6.5 protein. Length = 575 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/46 (28%), Positives = 27/46 (58%) Frame = -2 Query: 378 ISKTQTRSIGNKDWSNFKSLFDVGNT*RIKVMFYHERNQCINHAVD 241 + K QT++I + W+ + V +T +I V+FY++ + + A+D Sbjct: 520 LRKCQTQTIAPRSWNRISARIKVQSTEKIFVLFYNDAMEPKSIAID 565 >AL032657-8|CAB63370.1| 389|Caenorhabditis elegans Hypothetical protein Y47H9C.8 protein. Length = 389 Score = 27.9 bits (59), Expect = 6.4 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +1 Query: 250 MIDTLVPFMIKHDLDPLSIPDIEETFEVRPVLITYRASLGLTNG 381 ++ TL+ F+I L L P++++TFE Y SLG TNG Sbjct: 239 VVHTLLHFLIC--LAGLGAPELDQTFEEATDSSDYVESLGDTNG 280 >Z81560-4|CAB04546.1| 94|Caenorhabditis elegans Hypothetical protein K02E2.4 protein. Length = 94 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 69 CWCYKKHVQVFGCSNTGAVGCNRGP*FCCPEPI 167 C Y+K + + GC +T + R CCPEP+ Sbjct: 56 CQNYEK-ILMEGCGSTVMLTMQRTKLICCPEPV 87 >U40959-2|AAA81766.1| 413|Caenorhabditis elegans Hypothetical protein B0310.2 protein. Length = 413 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 156 PEPIPFSSQECRHS*LGRPWSNSRYQRIRRQH 251 P PIPFS+ LG P +N Y QH Sbjct: 179 PVPIPFSNAALMQRWLGHPLTNPAYLNAMFQH 210 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,840,122 Number of Sequences: 27780 Number of extensions: 294575 Number of successful extensions: 637 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -