BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10o13f (619 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 27 0.64 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 24 3.4 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 3.4 AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CY... 24 4.5 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 6.0 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 23 6.0 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 26.6 bits (56), Expect = 0.64 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +1 Query: 43 VFAAILSVAFGYQTTWTVHELSNAIQSPYTSAAVLPYLETALNQMMAAL 189 VF A+ +G +T V +LS P T+ + PY ALN++ A L Sbjct: 64 VFVAVARRRWGIPSTLNVVDLSPPF--PNTNVILKPYPNFALNELRADL 110 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 24.2 bits (50), Expect = 3.4 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 105 ELMHGPGSLVAEGHRQDSGEYSNEFH 28 +L+ GPGSL+ +G+Y +E + Sbjct: 26 DLLFGPGSLLYRPPNSMAGDYGDELY 51 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.2 bits (50), Expect = 3.4 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -2 Query: 186 SSHHLVES-RLKVGQDRSRSVRALDGIGELM 97 SSH V+S ++VG +R S+R L +G ++ Sbjct: 682 SSHKTVQSGSIRVGDERIESIRHLKYLGVII 712 >AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CYP4H15 protein. Length = 151 Score = 23.8 bits (49), Expect = 4.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 511 MFAGHEVTSICVSIPA 558 MF GH+ T+ C+S A Sbjct: 6 MFEGHDTTTSCISFAA 21 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.4 bits (48), Expect = 6.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 108 QCHPEPVHFCCGP 146 +C P+ V CCGP Sbjct: 54 ECPPDEVFKCCGP 66 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 23.4 bits (48), Expect = 6.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 183 CSSRRRKD*SCTRYHSRFGPHRNDH 257 C +R + CTRY S GP D+ Sbjct: 102 CRTRAGEKGHCTRYQSCKGPELKDN 126 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.129 0.363 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,034 Number of Sequences: 2352 Number of extensions: 14803 Number of successful extensions: 85 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -