BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10o09f (639 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces ... 30 0.32 SPAC25H1.02 |jmj1||Jmj1 protein|Schizosaccharomyces pombe|chr 1|... 25 9.2 >SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1429 Score = 29.9 bits (64), Expect = 0.32 Identities = 16/72 (22%), Positives = 35/72 (48%) Frame = +2 Query: 299 TINFQTFVNSFQNRLEPPVRQHLKNVYATLMMTCVSASAGVYVDMFTRFQAGFLSAIVGA 478 TI+ ++F E + ++ N+ + ++ + A+ V V++ TR + IVG Sbjct: 730 TIDIESFWTPVDVVEEKSAKTYIDNLVGVMRLSVIKANDLVNVELPTRKSDPYARVIVGN 789 Query: 479 GLMLMLIATPDN 514 ++ + TP+N Sbjct: 790 SVVARTVYTPNN 801 >SPAC25H1.02 |jmj1||Jmj1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 25.0 bits (52), Expect = 9.2 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 44 FKVRLLNSHWSIKSLHTTQFYSLPYSLQRRTKIICLFYCDL*NLNTVVASY 196 F+ L SH + LHT + S +S+ + C + D +L T+ + Y Sbjct: 223 FRFAYLGSHLTTTGLHTDVYASHSFSV-NLCGVKCWLFIDPKDLQTIASLY 272 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,734,077 Number of Sequences: 5004 Number of extensions: 56807 Number of successful extensions: 133 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -