BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10o05r (460 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 22 3.2 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 21 5.5 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.8 bits (44), Expect = 3.2 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -1 Query: 214 KFLLHKLLEYENDTESIHSSYRSDTLVNLNGPKSKVKKKQTLED 83 +F + ++E++ DT+ + Y V + PKS K Q +D Sbjct: 298 EFHKNGIIEWD-DTQKVPYLYDDTLWVGFDNPKSVALKAQYAKD 340 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.0 bits (42), Expect = 5.5 Identities = 13/42 (30%), Positives = 17/42 (40%) Frame = -1 Query: 289 ILENAALCDEVAKIQESILIVKDERKFLLHKLLEYENDTESI 164 IL LCD + K + IL + + L YE D I Sbjct: 165 ILSTIFLCDTILKKVDDILSQAYKLEASFDDLATYETDEVQI 206 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,609 Number of Sequences: 336 Number of extensions: 1594 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10511300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -