BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10o01r (397 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043693-5|AAB97532.1| 105|Caenorhabditis elegans Hypothetical ... 62 2e-10 AF016664-8|AAY44018.1| 397|Caenorhabditis elegans Hypothetical ... 27 3.7 U41270-5|AAA82442.2| 364|Caenorhabditis elegans Hypothetical pr... 27 6.4 U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical pr... 26 8.5 AC026301-11|AAK68891.2| 273|Caenorhabditis elegans Hypothetical... 26 8.5 >AF043693-5|AAB97532.1| 105|Caenorhabditis elegans Hypothetical protein C34B2.10 protein. Length = 105 Score = 61.7 bits (143), Expect = 2e-10 Identities = 25/71 (35%), Positives = 44/71 (61%), Gaps = 1/71 (1%) Frame = -1 Query: 295 IPTHIDYVGQAKAEKLYRAIITLFSIVGFVWGYIVQQFSQSVYXXXXXXXXXXXLTVPPW 116 + +HID+ GQ AE+ Y+ I+T+ I+GF+ G+ QQ S +++ + +PPW Sbjct: 15 LSSHIDFQGQKVAERTYQVILTIAGIIGFLVGFWTQQLSYAMFTVLGASAFTALIILPPW 74 Query: 115 P-MYRRNPLNW 86 P ++R+NP+ W Sbjct: 75 PFLFRKNPIVW 85 >AF016664-8|AAY44018.1| 397|Caenorhabditis elegans Hypothetical protein D2062.12 protein. Length = 397 Score = 27.5 bits (58), Expect = 3.7 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = -1 Query: 352 LLLWQVILI*FSKMDFFTSIPTHIDYVGQAKAEKLYRAIITL--FSIVG-FVWGYIVQQF 182 LL W+V I FT+ P + D +K EKL + +I + F +V FV ++V Sbjct: 335 LLAWKVFSINTRSHTVFTAFPEYFDDEITSKKEKLLKFVIWVDKFLMVALFVQSFVVMYL 394 Query: 181 SQ 176 ++ Sbjct: 395 AR 396 >U41270-5|AAA82442.2| 364|Caenorhabditis elegans Hypothetical protein AH9.4 protein. Length = 364 Score = 26.6 bits (56), Expect = 6.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 53 CWFVITVLRNLPVQRIASVHWPWRNSKNGSK 145 CWF ++VLR + V WR +N K Sbjct: 103 CWFFLSVLRYIAVFHPFKYRTIWRQPRNALK 133 >U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical protein C41A3.1 protein. Length = 7829 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 251 IIQGNNYIVQYSWFCMGLYSSAILAVSVYSWC 156 ++ N+Y+ Y+ +C+ L AVSVYS C Sbjct: 5449 VMNMNSYLASYASYCLDLKGE---AVSVYSAC 5477 >AC026301-11|AAK68891.2| 273|Caenorhabditis elegans Hypothetical protein Y54F10BM.12 protein. Length = 273 Score = 26.2 bits (55), Expect = 8.5 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -1 Query: 307 FFTSIPTHIDYVGQAKAEKLYRAIITL 227 F T P H+ Y+ Q + KL+R +++ Sbjct: 67 FMTGYPIHMSYITQTEIAKLFRKKLSI 93 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,394,454 Number of Sequences: 27780 Number of extensions: 154962 Number of successful extensions: 414 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 609015246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -