BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n24r (549 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G9.04c |||cleavage and polyadenylation specificity factor |... 31 0.11 SPBC16A3.04 |rsm25||mitochondrial ribosomal protein subunit Rsm2... 26 4.2 SPAC1D4.10 |||tRNA endonuclease|Schizosaccharomyces pombe|chr 1|... 26 4.2 SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transpo... 25 5.6 SPBC19G7.10c |||topoisomerase associated protein |Schizosaccharo... 25 9.7 >SPAC4G9.04c |||cleavage and polyadenylation specificity factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 31.1 bits (67), Expect = 0.11 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +3 Query: 195 QHVSGDSTVNGSVTLDAGILIDGPDLDVTELLRIRPSEYGQ*AALRIDLWLRM 353 QH+SG S G +TLD+ +L D + VTE R + Y A R ++ L++ Sbjct: 190 QHISGTSPSPGFITLDS-LLSDVNRMIVTEQARFIKNPYDNMAKKRFEILLQL 241 >SPBC16A3.04 |rsm25||mitochondrial ribosomal protein subunit Rsm25|Schizosaccharomyces pombe|chr 2|||Manual Length = 220 Score = 25.8 bits (54), Expect = 4.2 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 67 GKR-RSAQYCPQEQTPTRTRLWRRGPPESPWHWSRP 171 GKR R + Y PQE +L +R + PW +RP Sbjct: 57 GKRLRKSMYQPQEIQWPEDKLRKRFYRDHPWELARP 92 >SPAC1D4.10 |||tRNA endonuclease|Schizosaccharomyces pombe|chr 1|||Manual Length = 809 Score = 25.8 bits (54), Expect = 4.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 394 TWNWNQWWQSCGG 356 T N+ WW SCGG Sbjct: 114 TVNYPTWWDSCGG 126 >SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transporter Bfr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1530 Score = 25.4 bits (53), Expect = 5.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 367 SCGGNILNQRSILSAAHCPY 308 + GN+LN + S ++CPY Sbjct: 1451 TAAGNLLNPNATTSCSYCPY 1470 >SPBC19G7.10c |||topoisomerase associated protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 744 Score = 24.6 bits (51), Expect = 9.7 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = -3 Query: 349 LNQRSILSAAHCPYSEGLIRSNSVTSRSGPSIRMPASNVTDPLTVLSPLTCCALVFWTSV 170 +NQ++I + P S L + + + S R PAS + L+ L P+ W ++ Sbjct: 83 INQQNIFAKPVKPASSELPQVSRLNGASQFPSREPASTAINKLSDLQPMAS----IWENI 138 Query: 169 VATSARVTP 143 V + P Sbjct: 139 VPEKPAIIP 147 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,383,451 Number of Sequences: 5004 Number of extensions: 49922 Number of successful extensions: 132 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -