BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n22r (661 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. 25 2.8 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 2.8 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 25 2.8 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 25 2.8 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 24 3.7 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 24 4.9 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 8.5 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 8.5 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 8.5 >Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. Length = 111 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 84 VEGLGKSDSGSRDDRGTNNYGLDDFG 161 + G G+S + S + GT+ GL DFG Sbjct: 35 INGTGQSFNFSGESNGTSIPGLPDFG 60 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -2 Query: 180 APQPCPPRSRQARNCWYPYHPGSRCHSSRDPQ 85 A P PP ++ C H S C S+ D Q Sbjct: 497 AAPPTPPERQRCFRCLEMGHIASNCRSTADRQ 528 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 84 VEGLGKSDSGSRDDRGTNNYGLDDFG 161 + G G+S + S + GT+ GL DFG Sbjct: 35 INGTGQSFNFSGESNGTSIPGLPDFG 60 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 24.6 bits (51), Expect = 2.8 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -2 Query: 159 RSRQARNCWYPYHPGSRCHSSRDPQLSQLTDILA 58 +++ RNC P H G C +R + + + + A Sbjct: 25 QAQTCRNCAAPVHHGLNCVQNRQNRFANVVQVKA 58 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +2 Query: 416 EQVRRRWARRCQQEQVQQR 472 +Q R+RW ++ Q++Q QQR Sbjct: 188 DQQRQRWRQQQQKQQRQQR 206 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.8 bits (49), Expect = 4.9 Identities = 8/36 (22%), Positives = 18/36 (50%) Frame = -3 Query: 416 LVDTYEPISVGPAIVEGAPVTVTGADGTPLVQIIIN 309 +++ + + +EG +TV DG P+ + +N Sbjct: 390 MINAFASVCPAQVTIEGHALTVIATDGEPVHPVQVN 425 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 263 DIAEEPLPEVVILPTPVFPEI 201 D+ E P I+P P FP+I Sbjct: 546 DMKEAPTTNPRIVPIPTFPQI 566 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 15 DHHFCIFIYNYTVLLQ 62 D HF +F YT LLQ Sbjct: 357 DRHFLLFCMVYTTLLQ 372 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 8.5 Identities = 35/156 (22%), Positives = 55/156 (35%), Gaps = 7/156 (4%) Frame = +3 Query: 96 GKSDSGSRDDRGTNNYGLDDFGEDRAGELHGFRNVDFRKYGSGE-------NNNFGQRLF 254 G S R ++ G D E+ GE G R + G+ + Q+ Sbjct: 950 GGGGSRKRKEKARRGSGGDSDSEEEEGE--GSRKRKKKGASGGQKKRQKAMDEGLSQKQK 1007 Query: 255 GNVLNINGISGNLGRTVHVDDDLDEGSAISAGDSHRGTFNNGRSNRDGLVGVNKSRSDGD 434 G +L+ +S T D D D I++GD G + R + ++ SDG Sbjct: 1008 GRILSKATVS-----TSESDSD-DSRLKIASGDESGGESGAPATKRKRRIASDEEDSDGS 1061 Query: 435 GLVGVNKSRSNRDGHVGVNKSRSNRDGFVGVNKSRS 542 ++SRS +R G + SRS Sbjct: 1062 QRRSRSRSRSGSGSRSRSRSGSGSRAGSRAGSGSRS 1097 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 569,169 Number of Sequences: 2352 Number of extensions: 12146 Number of successful extensions: 46 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -