BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n17r (443 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52838| Best HMM Match : DUF1280 (HMM E-Value=2) 33 0.14 SB_6778| Best HMM Match : fn3 (HMM E-Value=0.13) 33 0.14 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 33 0.14 SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_2147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_17842| Best HMM Match : RVT_1 (HMM E-Value=2.2e-29) 30 0.75 SB_59573| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.99 SB_51553| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_2119| Best HMM Match : DUF11 (HMM E-Value=0.84) 28 3.0 SB_10056| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=7.7e-05) 28 4.0 SB_38614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_18513| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_30541| Best HMM Match : PSI_PsaJ (HMM E-Value=4) 27 7.0 SB_42793| Best HMM Match : PARP (HMM E-Value=5.4e-22) 27 9.2 SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_26957| Best HMM Match : PDZ (HMM E-Value=0) 27 9.2 >SB_52838| Best HMM Match : DUF1280 (HMM E-Value=2) Length = 280 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 275 DKYKTITVDSNGTKETVFESGVPFDETIDGVLTIKTTYTVDGNTV 141 D +K + V ++G E V E FD+T G + K VDGN V Sbjct: 98 DNFKQVHVVADGFTELVTEYKAVFDDTAVGCFSGKVNLKVDGNAV 142 >SB_6778| Best HMM Match : fn3 (HMM E-Value=0.13) Length = 464 Score = 32.7 bits (71), Expect = 0.14 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -1 Query: 266 KTITVDSNGTKETVFESGV-PFDETIDGVLTIKTTYTVDGNTVTHVV 129 K ++D + +T++ SGV P+D T + LTI+ T + +T+T +V Sbjct: 20 KDHSLDRYDSTQTIYVSGVKPYDRTFNHSLTIQQTSIITASTLTRLV 66 >SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) Length = 2009 Score = 32.7 bits (71), Expect = 0.14 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -1 Query: 209 PFDETIDGVLTIKTTYTVDGNTVTHVVENPNGTATFKREYGD-TELKVTISADKWDGVAY 33 PF+ I L YT++ + V V G AT+K +Y + E +TI A DG + Sbjct: 1558 PFELFISSTLEKAINYTIETSGVNTTVVTSTGKATWKHKYLEPLEGNITIIASA-DGESI 1616 Query: 32 RYY 24 R+Y Sbjct: 1617 RFY 1619 >SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 275 DKYKTITVDSNGTKETVFESGVPFDETIDGVLTIKTTYTVDGNTV 141 D +K + V ++G E V E FD+T G + K VDGN V Sbjct: 29 DNFKQVHVVADGFTELVTEYKAVFDDTAVGCFSGKVNLKVDGNAV 73 >SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1669 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 275 DKYKTITVDSNGTKETVFESGVPFDETIDGVLTIKTTYTVDGNTV 141 D +K + V ++G E V E FD+T G + K VDGN V Sbjct: 304 DNFKQVHVVADGFTELVTEYKAVFDDTAVGCFSGKVNLKVDGNAV 348 >SB_2147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 275 DKYKTITVDSNGTKETVFESGVPFDETIDGVLTIKTTYTVDGNTV 141 D +K + V ++G E V E FD+T G + K VDGN V Sbjct: 73 DNFKQVHVVADGFTELVTEYKAVFDDTAVGCFSGKVNLKVDGNAV 117 >SB_17842| Best HMM Match : RVT_1 (HMM E-Value=2.2e-29) Length = 1167 Score = 30.3 bits (65), Expect = 0.75 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -1 Query: 284 KEGDKYKTITVD--SNGTKETVFESGVPFDETIDGVLTIKTTYTVDGNTV 141 K ++ K ITV ++G E V E FD+T G + K VDGN V Sbjct: 370 KAAEQMKLITVHVVADGFTELVTEYKAVFDDTAVGCFSGKVNLKVDGNAV 419 >SB_59573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 29.9 bits (64), Expect = 0.99 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 275 DKYKTITVDSNGTKETVFESGVPFDETIDGVLTIKTTYTVDGNTV 141 D +K + V ++G E V E FD+T G K VDG+ V Sbjct: 57 DNFKQVHVVADGFTELVTEYKAVFDDTAVGCFPGKVNLKVDGDAV 101 >SB_51553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1036 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -1 Query: 404 LGKKYTFDREENFDGFLKFVGLPEDQIRKLLQFK 303 L +KY F+R E F+ ++ +GL D + L QF+ Sbjct: 746 LSQKYPFERAEKFNKGIRKLGLSPDGLTYLDQFR 779 >SB_2119| Best HMM Match : DUF11 (HMM E-Value=0.84) Length = 273 Score = 28.3 bits (60), Expect = 3.0 Identities = 20/82 (24%), Positives = 32/82 (39%), Gaps = 4/82 (4%) Frame = -1 Query: 299 TTTLIKEG-DKYKTITVDSNGTKETVFESGVPFDETIDGVLTIKTTY---TVDGNTVTHV 132 T+T+ +G Y +D NG + + V + I L T V + H+ Sbjct: 66 TSTISNQGAGTYSCTIIDQNGCTQQLDNLIVDENPAITVTLNFITNLLDPAVSNGAINHI 125 Query: 131 VENPNGTATFKREYGDTELKVT 66 V G+ T+ G+T L T Sbjct: 126 VSGGTGSYTYAWSNGNTSLNAT 147 >SB_10056| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=7.7e-05) Length = 1960 Score = 27.9 bits (59), Expect = 4.0 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 3/72 (4%) Frame = +1 Query: 184 TPSMVSSKGTPDSKTVSFV-PLLSTVMVLYLSPSLI--NVVVGLNCKSFRIWSSGRPTNL 354 +PS VS+ T DS +VSF LLST ++ +S S++ N V + R+ +S ++ Sbjct: 529 SPSYVSNMTTLDS-SVSFTRSLLSTTLIPSISTSILPYNTTVIATPNTTRLVTSTISSST 587 Query: 355 RNPSKFSSLSNV 390 N S S+ S++ Sbjct: 588 VNVSAISTTSSI 599 >SB_38614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 227 VFESGV-PFDETIDGVLTIKTTYTVDGNTVTHVV 129 ++ SGV P+D T + LTI+ T + +T+T +V Sbjct: 1 IYVSGVKPYDRTFNHSLTIQQTSIITASTLTRLV 34 >SB_18513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4634 Score = 27.5 bits (58), Expect = 5.3 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 341 LPEDQIRKLLQFKPTTTLIKEGDKYKTITVD-SNGTKETV 225 LP D + +F P+T +EG+K ++T+ S GTK + Sbjct: 1111 LPSDDPYGVFKFTPSTLTTQEGNKTVSLTITRSLGTKGAI 1150 >SB_30541| Best HMM Match : PSI_PsaJ (HMM E-Value=4) Length = 368 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 229 VSFVPLLSTVMVLYLSPSLINVVVGLNCKSFRIW 330 +S P+L +V L LSP+L +V + L C R+W Sbjct: 1 LSVAPVLRSVQTLSLSPALRSVALRLVC---RVW 31 >SB_42793| Best HMM Match : PARP (HMM E-Value=5.4e-22) Length = 585 Score = 26.6 bits (56), Expect = 9.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 418 QPCLSWVKNTHSIEKKTSM 362 QPC +W H IEK T++ Sbjct: 228 QPCHNWYPTVHKIEKVTNL 246 >SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2578 Score = 26.6 bits (56), Expect = 9.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 418 QPCLSWVKNTHSIEKKTSM 362 QPC +W H IEK T++ Sbjct: 1408 QPCHNWYPTVHKIEKVTNL 1426 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 26.6 bits (56), Expect = 9.2 Identities = 24/68 (35%), Positives = 29/68 (42%) Frame = -2 Query: 397 KNTHSIEKKTSMGSLSLSVSPKTRSGNFCSSSLQLH*SRKATNTRPSPSTATVQRRQFLS 218 K T + TS S S S +T S SSS Q S T T PS T+T + S Sbjct: 661 KVTSPQQTSTSPQETSTSSSKQT-STQQTSSSQQTSTSPPQTTTSPSQQTSTSPPQTTTS 719 Query: 217 PVCLSTKP 194 P +T P Sbjct: 720 PSQQTTSP 727 >SB_26957| Best HMM Match : PDZ (HMM E-Value=0) Length = 1685 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 233 ETVFESGVPFDETIDGVLTIKTTYTVDG 150 E +F GVPF+E++D + + T + G Sbjct: 219 ELIFPQGVPFEESVDQEVDVDTPLSQRG 246 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,654,498 Number of Sequences: 59808 Number of extensions: 317080 Number of successful extensions: 1116 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1110 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -