BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n17r (443 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 56 7e-10 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 31 0.024 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 31 0.024 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 2.8 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 3.7 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 22 8.5 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 22 8.5 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 22 8.5 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 22 8.5 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 22 8.5 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 55.6 bits (128), Expect = 7e-10 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 2/91 (2%) Frame = -1 Query: 401 GKKYTFDREENFDGFLKFVGLPEDQIRKL-LQFKPTTTLIKEGDKYKTITVDSNGTKETV 225 GKKY ++ E FD ++ +G+ +RKL PT L+K GD+Y T+ + T+ + Sbjct: 35 GKKYKMEKSEGFDDYMLALGVGM-VLRKLGNSISPTVELVKNGDEYTFNTLSPSRTRRSS 93 Query: 224 FESGVPFD-ETIDGVLTIKTTYTVDGNTVTH 135 + FD ET+DG + +K+ T DGN + H Sbjct: 94 SSWAMEFDEETVDGRM-VKSVCTFDGNKLIH 123 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 30.7 bits (66), Expect = 0.024 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = +3 Query: 126 LYNMSYGVSINCVRGFYRQYTIDGFVER-HTGLKNCLLCTVAVDGDGLVFVAFLDQCSCR 302 +Y + + +N +RQ TID +E HT N DG+ VF LD+ R Sbjct: 938 MYARLHLLHLNWKHEVHRQSTIDVLIEDLHTYTFN----PPETDGNTFVFAYQLDKEKFR 993 Query: 303 LELQKFPDLVFGETDKLKEPIE 368 L++ + E DK+K IE Sbjct: 994 LKVISHHGKIMDEVDKIKAQIE 1015 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 30.7 bits (66), Expect = 0.024 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = +3 Query: 126 LYNMSYGVSINCVRGFYRQYTIDGFVER-HTGLKNCLLCTVAVDGDGLVFVAFLDQCSCR 302 +Y + + +N +RQ TID +E HT N DG+ VF LD+ R Sbjct: 939 MYARLHLLHLNWKHEVHRQSTIDVLIEDLHTYTFN----PPETDGNTFVFAYQLDKEKFR 994 Query: 303 LELQKFPDLVFGETDKLKEPIE 368 L++ + E DK+K IE Sbjct: 995 LKVISHHGKIMDEVDKIKAQIE 1016 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.8 bits (49), Expect = 2.8 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -2 Query: 121 PMAQQHSKGNTVTPN*KLLSRPINGTALPIDTTKFK 14 P + GN VT K ++ +NG LPI + + Sbjct: 36 PYCVPRNNGNWVTDESKTVAIVVNGNRLPIQRIRHR 71 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.4 bits (48), Expect = 3.7 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -1 Query: 317 LLQFKPTTTLIKEGDKYKTITVDSNGTKETVFESGVPFDETIDGVL 180 L + +P+T+L G + + D+ + +SG P D T +G++ Sbjct: 98 LARDEPSTSLAVAGGSERRVQRDATSSGGRPGQSGSPPDPTRNGIV 143 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 22.2 bits (45), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 95 EYGDTELKVTISADK 51 +YGD E K TIS+ + Sbjct: 8 QYGDAESKTTISSSR 22 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 22.2 bits (45), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 95 EYGDTELKVTISADK 51 +YGD E K TIS+ + Sbjct: 8 QYGDAESKTTISSSR 22 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 22.2 bits (45), Expect = 8.5 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 159 CVRGFYRQYTIDGFVERHTGLK 224 C RGF ++ V HTG K Sbjct: 160 CERGFKTLASLQNHVNTHTGTK 181 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 22.2 bits (45), Expect = 8.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 362 HRSFLLYRMCIFYPRKT 412 HRSFL Y Y RKT Sbjct: 137 HRSFLCYHQHYGYLRKT 153 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 22.2 bits (45), Expect = 8.5 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 177 RQYTIDGFVERHTGLKNCLLCTVAVDGDGLVFV 275 + Y D + G +NC+ V V GLVF+ Sbjct: 421 KNYDADAYYPFGAGPRNCIGQGVLVSKIGLVFL 453 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,086 Number of Sequences: 2352 Number of extensions: 9769 Number of successful extensions: 20 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -