BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n17f (487 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 2.6 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 3.4 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 4.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 5.9 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 7.9 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 218 TVSFVPLLSTVMVLYLSPSLINVV 147 TV +P++ +VLY + L NVV Sbjct: 136 TVYLLPIIINPLVLYEARKLANVV 159 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 3.4 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = +1 Query: 127 LLQFKPTTTLIKEGDKYKTITVDSNGTKETVFESGVP 237 +LQ +P+T+ + D ++ + S+GT + +P Sbjct: 51 ILQVRPSTSAAADVDGWQVTPLPSDGTTSPEPDPEIP 87 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 338 HSKGNTVTP 364 HS GNTVTP Sbjct: 12 HSLGNTVTP 20 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +1 Query: 31 MSFLGKKYTFDREENFDGFLKFVGLPEDQIRKL 129 ++F+ YT + FDG PE++ +K+ Sbjct: 133 LAFVNSAYTLVKAYGFDGLDLAWEFPENKPKKI 165 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 20.6 bits (41), Expect = 7.9 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 5/32 (15%) Frame = +1 Query: 286 VDGNTVTHVVEN-----PNGTATFKREYGDTE 366 +D N TH+ PNGT E+GD E Sbjct: 48 IDPNICTHINYAFLGVYPNGTLQMIDEWGDIE 79 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,345 Number of Sequences: 336 Number of extensions: 2713 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11315916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -