BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n15r (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosacc... 27 2.9 SPBC947.06c |||spermidine family transporter |Schizosaccharomyce... 26 5.0 >SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 27.1 bits (57), Expect = 2.9 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = -2 Query: 391 FVDSSFPTNSIAASTKMGKLKERYG--NIRNNLSKAVGAKRKQDGRKEMQG*HRDNALAE 218 F FP+ I+ S K +++ +Y N+R + A RK+D + H NAL E Sbjct: 229 FPQEIFPSKKISLSAKR-RIQGKYSGENVRARIELARERNRKRDYVSNLSKGHTTNALEE 287 >SPBC947.06c |||spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 498 Score = 26.2 bits (55), Expect = 5.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 254 FFSSILFPLGTYSLTKVVSYVAVAFF 331 FF SILF +GT S V + + FF Sbjct: 129 FFLSILFTIGTASSDSVAAIMCTRFF 154 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,579,903 Number of Sequences: 5004 Number of extensions: 49306 Number of successful extensions: 118 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -