BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n15f (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 5.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 6.6 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 8.7 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 8.7 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 5.0 Identities = 14/58 (24%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = +2 Query: 233 YDLRTVEILGCGTRVPCFVTL----GNEVPVILKFRADFSSRKLDQDVVININHVNLK 394 YD+ ++ LG R+ F+ L PV+ ++ DF +++ V ++N +K Sbjct: 561 YDV-SLSGLGSDRRLELFLELLPMLAPGAPVMTRYLGDFEGNQVEGSPVTSLNREEIK 617 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 332 DFSSRKLDQDVVININHVNLKTPVTP 409 DFS R D + + VNL P TP Sbjct: 207 DFSKRGQKSDADSDSDVVNLSKPGTP 232 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 140 LCSTYNSDHYPI 105 + S YN+D YPI Sbjct: 5 MVSVYNNDFYPI 16 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 161 SSLSWSTLCSTYNSDHYPI 105 +SLSW+ CS ++ P+ Sbjct: 175 NSLSWNNPCSINSTSSQPV 193 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,733 Number of Sequences: 336 Number of extensions: 2827 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -