BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n15f (645 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 32 0.014 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 31 0.031 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 31 0.041 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 25 1.6 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 2.0 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 24 3.6 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 3.6 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 3.6 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 23 6.3 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 8.3 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 32.3 bits (70), Expect = 0.014 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 200 SAIDLSICTPQLASSLSWSTLCSTYNSDH 114 S IDL+ C+P LASS++W + SDH Sbjct: 167 SIIDLTFCSPALASSMNWRVSNAYTLSDH 195 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 31.1 bits (67), Expect = 0.031 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 215 PGEVISAIDLSICTPQLASSLSWSTLCSTYNSDHYPIII 99 PG S +DL+ + +A S W L S NSDH I I Sbjct: 168 PGRT-SVVDLTFASRTVARSFKWEVLSSYMNSDHRAIRI 205 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 30.7 bits (66), Expect = 0.041 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 Query: 200 SAIDLSICTPQLASSLSWSTLCSTYNSDHYPIIIS 96 SAIDL+ + L + W L NSDH I+I+ Sbjct: 173 SAIDLTFVSQSLMETTGWEVLPDYMNSDHIGILIT 207 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 200 SAIDLSICTPQLASSLSWSTLCSTYNSDH 114 S ID++ +P + +W L S + SDH Sbjct: 170 SVIDVTFASPSIVRYNTWEVLKSYWYSDH 198 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 200 SAIDLSICTPQLASSLSWSTLCSTYN-SDH 114 S +D++ TP +A +W+ +C Y+ SDH Sbjct: 173 SIVDVAFATPTIAQPGTWN-VCGDYSYSDH 201 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 24.2 bits (50), Expect = 3.6 Identities = 16/57 (28%), Positives = 24/57 (42%) Frame = +2 Query: 209 HQAL*GSAYDLRTVEILGCGTRVPCFVTLGNEVPVILKFRADFSSRKLDQDVVININ 379 HQ L S Y L + GT VPC + + R+ + +KL + + I N Sbjct: 546 HQVLYPSLYTLAMSTLCIPGTSVPCERLFSKAGQIYSEKRSRLAPKKLQEILFIQQN 602 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.2 bits (50), Expect = 3.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 154 REDANWGVQMDRSMALITS 210 + + NW V D+S+A++TS Sbjct: 40 QNNGNWVVDRDKSVAIVTS 58 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 200 SAIDLSICTPQLASSLSWSTLCSTYNSDH 114 S +D++ C+ L+ L+W + SDH Sbjct: 165 SIVDITFCSTTLSERLNWRVSDALTLSDH 193 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 372 LITTSWSNFLDEKSARNFNITGTSLP 295 L T +WS++LD ++ +F S P Sbjct: 254 LPTVAWSSYLDVRNRDDFRQLNVSFP 279 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 8.3 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = -2 Query: 281 KVLESHNLVFLQSLSRRQILTKPGEVISAIDLSICTPQLASSLSWSTLCSTYNSDHYPII 102 ++++S L + S + + + S ID+ TP +A +W + SDH I Sbjct: 165 QLIQSVQLQVINSGNEPTFIGRGAATSSVIDVCFATPSIARPETWE-VHEFARSDHQLIT 223 Query: 101 IS 96 S Sbjct: 224 YS 225 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 625,658 Number of Sequences: 2352 Number of extensions: 11134 Number of successful extensions: 42 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -