BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n10f (573 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0654 - 4791998-4792085,4792250-4792674 33 0.12 10_08_0132 + 15087274-15087797,15089544-15089732,15090048-150901... 31 0.86 11_01_0137 - 1137979-1138257,1138419-1138970,1139052-1139409,113... 28 4.6 08_02_1084 - 24232968-24234779 28 6.1 07_03_0997 - 23203166-23203330,23203627-23203693,23203771-232038... 28 6.1 01_06_0575 - 30357556-30357582,30357698-30357944,30358039-303581... 28 6.1 12_02_0289 - 16914975-16916238,16916246-16916484 27 8.0 >03_01_0654 - 4791998-4792085,4792250-4792674 Length = 170 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 16 QPKMAEAFQVAKKQDLPPPGGYKPIPF-KRIPAK 114 +P MA + QD PPPGG+ P+ + +RIP K Sbjct: 79 KPGMASVKDMPVLQDGPPPGGFAPVRYARRIPTK 112 >10_08_0132 + 15087274-15087797,15089544-15089732,15090048-15090186, 15090454-15090594,15091420-15091569,15091908-15092011, 15092258-15092432,15092714-15092823,15092906-15093073, 15093180-15093345,15093771-15094049,15094445-15094543, 15094619-15094676,15095145-15095336,15095693-15095724, 15096023-15096117,15096321-15096426 Length = 908 Score = 30.7 bits (66), Expect = 0.86 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 222 LNLILKNSLVSYVIEIYRTNCHSNEPRKH 136 L+ +LK S VSYV E + TNC +E +H Sbjct: 755 LDAVLKLSEVSYVEECFSTNCQPDEFNQH 783 >11_01_0137 - 1137979-1138257,1138419-1138970,1139052-1139409, 1139577-1139869,1140623-1140675,1140785-1140941, 1141666-1141683,1141846-1141929,1142005-1142064, 1142182-1142222,1142316-1142451 Length = 676 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/80 (21%), Positives = 43/80 (53%), Gaps = 7/80 (8%) Frame = +1 Query: 166 GSIYLYNITYKRILKDEIEMRSAKM-----AIYPALLAERDRE-YLKQLRRNRDAEAELM 327 GS L+++ YK ++KD I R A YP++ +++E + ++L++N ++ Sbjct: 210 GSYCLWSVEYKEVMKDFIVKRLKDQLFMARAHYPSIAKLKNQETFTRELKQNIQEHERML 269 Query: 328 RD-VPGWEVGTYYGERVYKL 384 D + ++ ++ +++ K+ Sbjct: 270 SDTIADADLPPFFAKKLEKM 289 >08_02_1084 - 24232968-24234779 Length = 603 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 265 ERDREYLKQLRRNRDAEAELMRD 333 ERDR+Y ++ R+RD E E RD Sbjct: 515 ERDRDYDRERERDRDRERERDRD 537 >07_03_0997 - 23203166-23203330,23203627-23203693,23203771-23203862, 23204820-23204956,23205050-23205116,23205212-23205278, 23205356-23205441,23206061-23206153,23206337-23206522, 23207316-23207372,23207455-23207582,23207662-23207731, 23207815-23207950,23208378-23208529,23208606-23208680, 23208765-23208929,23209063-23209128,23209229-23209333, 23209929-23210132,23210462-23211715 Length = 1123 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 223 MRSAKMAIYPALLAERDREYLKQL 294 +RSAK+A+ L RD Y+KQL Sbjct: 748 LRSAKLAVEKGLAQGRDESYVKQL 771 >01_06_0575 - 30357556-30357582,30357698-30357944,30358039-30358161, 30358275-30358301,30358475-30358633,30359764-30359948, 30360225-30360293,30360432-30362354,30363018-30363339, 30363506-30363543 Length = 1039 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 362 TENASTNLFPPTSWSNQSSKSTMHTVTSKSGT 457 +EN S L PP+ S Q+S ST+ + K GT Sbjct: 290 SENVSLKLIPPSDMSVQTS-STLKDLVKKEGT 320 >12_02_0289 - 16914975-16916238,16916246-16916484 Length = 500 Score = 27.5 bits (58), Expect = 8.0 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -1 Query: 96 KWNWLVAPRRGQILFFSHLKSFSHLWLDFEFS 1 +W L+A R ++LF +H+K +W + ++ Sbjct: 166 QWRELIAKNRQRLLFTNHVKDGKSMWSNVPYN 197 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,398,797 Number of Sequences: 37544 Number of extensions: 331497 Number of successful extensions: 997 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 996 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -