BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n09r (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 1.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.3 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.8 bits (49), Expect = 1.7 Identities = 9/46 (19%), Positives = 21/46 (45%) Frame = +1 Query: 604 HQIGNLEQSCSWRTLLFVYQTGCVHQPANPGSLVLLQRLQLDRPSP 741 H+ + + W ++F+Y C+ + + P + + +PSP Sbjct: 320 HRNADTHEMSEWVKVVFLYWLPCILRMSRPSDKEEREAQKSQKPSP 365 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 675 TPASQPW*FSTAATSTT 725 +PAS P S AATS+T Sbjct: 822 SPASSPRYLSAAATSST 838 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,576 Number of Sequences: 438 Number of extensions: 5382 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -