BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n08r (773 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1027| Best HMM Match : Carb_anhydrase (HMM E-Value=0) 99 2e-21 SB_43059| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_28654| Best HMM Match : Carb_anhydrase (HMM E-Value=7.3e-09) 64 1e-10 SB_59634| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_3617| Best HMM Match : Carb_anhydrase (HMM E-Value=3.4e-15) 49 4e-06 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 41 0.001 SB_16664| Best HMM Match : Carb_anhydrase (HMM E-Value=1.7e-05) 34 0.11 SB_22648| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_23595| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_43773| Best HMM Match : TPR_1 (HMM E-Value=0.26) 29 3.2 SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_50120| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_12059| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_43285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 28 9.6 >SB_1027| Best HMM Match : Carb_anhydrase (HMM E-Value=0) Length = 291 Score = 99 bits (238), Expect = 2e-21 Identities = 59/169 (34%), Positives = 79/169 (46%), Gaps = 8/169 (4%) Frame = -3 Query: 768 YIFEQMHFHWSVDDFTGCEHVLDGHGYAAECHFVHYNSKYESLETAVGHPDGLAVVGFLL 589 Y Q HFH D G EH + G Y E H VHYN KY + +A G DGLAV+ L Sbjct: 116 YRLAQFHFHVGSSDIQGSEHHIHGVKYPLEMHLVHYNDKYPNASSAQGLLDGLAVISVLF 175 Query: 588 ETVDAPNPRFDRLVQGLEGIQKRE---SVMNVTSESLLWMDREDLQIGNYVTYKGSLTTP 418 E+ NP + ++ L+ ++ +V NV ++ D E + Y GSLTTP Sbjct: 176 ESSSTDNPALNEIIDNLQNASYKDEEITVQNVPVGKIIPTDTE-----KFYRYNGSLTTP 230 Query: 417 PYTECVTWIIYEKPVQIGSEQLGLLRQLEGPDSQ-----PIERNVRPTQ 286 P E V WI+ +K I +QL R + Q + N RPTQ Sbjct: 231 PCFETVKWIVLKKTASISEKQLRQFRSVFSTSRQATKPNSLVDNFRPTQ 279 >SB_43059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 96.3 bits (229), Expect = 2e-20 Identities = 57/163 (34%), Positives = 81/163 (49%), Gaps = 3/163 (1%) Frame = -3 Query: 768 YIFEQMHFHWSVDDFTGCEHVLDGHGYAAECHFVHYNSKYESLETAVGHPDGLAVVGFLL 589 Y Q H HW + G EH++DG +A H V YN+KY ++ AV DGLAVVG LL Sbjct: 515 YSTVQFHLHWGSKNEQGSEHLIDGKAFAGAIHIVSYNTKYPNISAAVDKSDGLAVVGILL 574 Query: 588 ETVDAPNPRFDRLVQGLEGIQKRESVMNVTSESLLWMDREDL--QIGNYVTYKGSLTTPP 415 + V + + ++ + + K +N + E DL N+ Y+GSLTTP Sbjct: 575 K-VGTESAALKKFMENIGSVTK----VNTSDEFAQPAKLGDLLPSNKNFYRYQGSLTTPG 629 Query: 414 YTECVTWIIYEKPVQIGSEQLGLLRQLEGPDS-QPIERNVRPT 289 E VTW + P+ + QL +LR L+ D I+ N R T Sbjct: 630 CQESVTWSVMANPITVSEAQLAILRGLKQKDGVAVIQDNFRNT 672 >SB_28654| Best HMM Match : Carb_anhydrase (HMM E-Value=7.3e-09) Length = 252 Score = 64.1 bits (149), Expect = 1e-10 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = -3 Query: 756 QMHFHWSVDDFTGCEHVLDGHGYAAECHFVHYNSKYESLETAVGHPDGLAVVGFLLE 586 Q H H DD G EH++DG AA H V+YN+KY + TA DGLAV+G +LE Sbjct: 196 QFHMHLGEDDTRGAEHLIDGQRNAACIHIVNYNTKYPDISTAANKSDGLAVIGVILE 252 >SB_59634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 63.3 bits (147), Expect = 2e-10 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 5/73 (6%) Frame = -3 Query: 771 EYIFEQMHFHWSVDDFTGCEHVLDGHGYAAECHFVHYNSK-YESLETAVG--HPDGLAVV 601 +Y F Q HFHW D+ G EH +DG Y +E H VHYNS Y+ +A+ + DGL V+ Sbjct: 10 KYKFAQFHFHWGKDEKEGSEHRVDGKMYPSEMHIVHYNSDLYKDAASAMSSDNKDGLCVL 69 Query: 600 GFLLE--TVDAPN 568 G LE +V PN Sbjct: 70 GVFLEGSSVAVPN 82 >SB_3617| Best HMM Match : Carb_anhydrase (HMM E-Value=3.4e-15) Length = 338 Score = 49.2 bits (112), Expect = 4e-06 Identities = 20/56 (35%), Positives = 31/56 (55%) Frame = -3 Query: 768 YIFEQMHFHWSVDDFTGCEHVLDGHGYAAECHFVHYNSKYESLETAVGHPDGLAVV 601 Y E + FH+ +D+ G EH +DG + E + +N+KY ++ A DGL VV Sbjct: 102 YQLETVRFHFGCNDWLGSEHAVDGRRHPGEIQMIFHNTKYSNVSDAADKSDGLLVV 157 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = -3 Query: 450 YVTYKGSLTTPPYTECVTWIIYEKPVQIGSEQLGLLRQLE 331 Y +YKGS T P E V WII ++PV I +++ LR+LE Sbjct: 176 YYSYKGSQTAPACHESVRWIIVKQPVDIYRDEMAYLRRLE 215 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/44 (43%), Positives = 25/44 (56%) Frame = -3 Query: 453 NYVTYKGSLTTPPYTECVTWIIYEKPVQIGSEQLGLLRQLEGPD 322 ++ YKGSLTTPP E VTW + + I +QL LR + D Sbjct: 740 DFFRYKGSLTTPPCYESVTWTVMKTKTTISHDQLMKLRSIMEKD 783 >SB_16664| Best HMM Match : Carb_anhydrase (HMM E-Value=1.7e-05) Length = 134 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 771 EYIFEQMHFHWSV-DDFTGCEHVLDGHGYAAECHFVH 664 EY + FHW+ ++ G EH++D G+A E + +H Sbjct: 90 EYQLAMIKFHWAATEESAGSEHMIDSQGHAIEVNALH 126 >SB_22648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 770 STSSSRCTSTGP*MTSPDASTCSMATGTPQNATSSTITVNTNPW 639 ST++S TST T+ +T + T T + T++TIT + W Sbjct: 53 STTTSTTTSTTNTSTTTSTTTSTTNTSTTTSTTTTTITYKRDKW 96 >SB_23595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 29.9 bits (64), Expect = 2.4 Identities = 23/85 (27%), Positives = 33/85 (38%) Frame = -2 Query: 625 PSRWIGCGRIPPGDCRRSQPEVR*TSTRSGGDSEEGVSHECYFRIPIMDGQRRPSNRQLR 446 PS I CG +P + PE R ++ E+ SH+ Y R + SN Sbjct: 97 PSEDIYCGELPYHIFNNTSPETRSNTSERESLGEKIHSHDLYGRSLFPQAAEKQSNETRM 156 Query: 445 DLQGLPDDTALHRVCHLDHLRETCT 371 D P+ +VC + TCT Sbjct: 157 D--SWPEARDEKQVCSNNLPDSTCT 179 >SB_43773| Best HMM Match : TPR_1 (HMM E-Value=0.26) Length = 419 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 495 ESLLWMDREDLQIGNYVTYKGSLTTPPYT 409 E+ WM+ ++G+ V Y+GSL P YT Sbjct: 183 EARQWMEESLKRLGSSVRYRGSLQKPGYT 211 >SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 28.3 bits (60), Expect = 7.3 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 770 STSSSRCTSTGP*MTSPDASTCSMAT--GTPQNATSSTITVNTNP 642 STS+S T+T P T+P +T T T +A ++T T P Sbjct: 775 STSTSAATTTAPPTTAPPTTTKEPTTDASTSTSAATTTAPATTTP 819 >SB_50120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 27.9 bits (59), Expect = 9.6 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -3 Query: 669 VHYNSKYESLETAVGHPDGLAVVGFLLETV---DAPNPRF 559 V + + Y S+E A DGL VVG L+ + ++ NP F Sbjct: 2 VFFKTVYGSVEKAADKTDGLTVVGVFLKKISLLNSVNPSF 41 >SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 27.9 bits (59), Expect = 9.6 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -3 Query: 594 LLETVDAPNPRF--DRLVQGLEGIQKRESVMNVTSESLLWMDRE 469 L+ET A N R R+V LEG++ + + + +S + +W D+E Sbjct: 666 LIETCTALNMRILNGRVVGDLEGLRYQNNDIKESSVNKMWFDKE 709 >SB_12059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 399 TWIIYEKPVQIGSEQLGLLRQL 334 TWI+Y KP ++ +E G L L Sbjct: 160 TWIVYNKPKELTNEHAGFLMAL 181 >SB_43285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 27.9 bits (59), Expect = 9.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 519 PSSESPPDLVLVYRTSGWERRQSPGGIR 602 P SPP L YRTS R SP G R Sbjct: 68 PEIPSPPYQELAYRTSRQSRESSPSGGR 95 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 399 TWIIYEKPVQIGSEQLGLLRQL 334 TWI+Y KP ++ +E G L L Sbjct: 4 TWIVYNKPKELTNEHAGFLMAL 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,957,350 Number of Sequences: 59808 Number of extensions: 568491 Number of successful extensions: 1689 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1684 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -