BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n04r (772 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21165| Best HMM Match : LRR_1 (HMM E-Value=6.5e-13) 31 1.0 SB_40653| Best HMM Match : ABC_tran (HMM E-Value=0) 29 4.2 >SB_21165| Best HMM Match : LRR_1 (HMM E-Value=6.5e-13) Length = 1383 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/59 (33%), Positives = 31/59 (52%) Frame = +2 Query: 77 VKMIVLISYPAM*REPNKRLFSRDRKYI*SLRQTERVISARQSAKLTQRYDAVMGCTIK 253 +KM VL+S R P K L+ RDR + + QTE + + LT+ D +GC ++ Sbjct: 805 LKMEVLLSSNVGSRIPQKCLYFRDR--VLEISQTEPELQEQPIMTLTRLRDIALGCGMR 861 >SB_40653| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 672 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +2 Query: 149 RKYI*SLRQTERVISARQSAKLTQRYDAVMGCTIKVTYRQTK 274 R ++ + RQ +R+ S +S + Y+++ GCTI +RQ + Sbjct: 259 RLFVSTSRQLKRLESVSRSPIYSHFYESITGCTIIRAFRQQR 300 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,009,137 Number of Sequences: 59808 Number of extensions: 320658 Number of successful extensions: 424 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -