BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10n04f (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 25 0.73 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 21 6.8 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 24.6 bits (51), Expect = 0.73 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -2 Query: 205 FVLLPYFEFSSACNDCPASSAMSKIAICLTPSSN--NILTTDSPMP 74 F+L Y S AC DCP ++ C+ N +I+ + MP Sbjct: 61 FLLEWYHTLSKACYDCPYNTQDCYREDCIPGDGNKRSIIVVNRKMP 106 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 597 CLLHQGTLSVLGPRFSKSVP 538 CL+ +GT S G K++P Sbjct: 49 CLMERGTCSPDGEELKKALP 68 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,237 Number of Sequences: 336 Number of extensions: 3330 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -