BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10m23f (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45862| Best HMM Match : GMP_synt_C (HMM E-Value=0) 49 4e-06 SB_37142| Best HMM Match : Peptidase_A22B (HMM E-Value=0) 45 5e-05 SB_52206| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 41 0.001 SB_20791| Best HMM Match : Trypsin (HMM E-Value=4.8e-12) 40 0.002 SB_10167| Best HMM Match : Trypsin (HMM E-Value=0) 40 0.002 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 37 0.012 SB_31846| Best HMM Match : Trypsin (HMM E-Value=0) 37 0.012 SB_4906| Best HMM Match : Trypsin (HMM E-Value=0) 37 0.012 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_33775| Best HMM Match : Trypsin (HMM E-Value=0.012) 35 0.050 SB_1442| Best HMM Match : SRCR (HMM E-Value=0) 35 0.050 SB_35844| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 35 0.066 SB_32296| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.066 SB_17890| Best HMM Match : Trypsin (HMM E-Value=3.2) 35 0.066 SB_10942| Best HMM Match : PDZ (HMM E-Value=2.3e-08) 35 0.066 SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) 34 0.087 SB_26181| Best HMM Match : DUF963 (HMM E-Value=0.00098) 34 0.087 SB_31648| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_55505| Best HMM Match : Trypsin (HMM E-Value=0) 33 0.15 SB_48467| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-21) 33 0.15 SB_21575| Best HMM Match : Trypsin (HMM E-Value=0) 33 0.20 SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) 33 0.20 SB_21521| Best HMM Match : Trypsin (HMM E-Value=1.7e-23) 33 0.27 SB_44747| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_30267| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.35 SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_11021| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_6689| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) 32 0.35 SB_50121| Best HMM Match : DoxX (HMM E-Value=1.6) 32 0.47 SB_48048| Best HMM Match : Trypsin (HMM E-Value=3.64338e-44) 32 0.47 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_22688| Best HMM Match : Ribosomal_L21p (HMM E-Value=1.7) 32 0.47 SB_59013| Best HMM Match : DoxX (HMM E-Value=1.6) 32 0.47 SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_26443| Best HMM Match : Trypsin (HMM E-Value=3e-22) 31 0.62 SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.62 SB_36638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_32455| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_29414| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_6828| Best HMM Match : Spo0M (HMM E-Value=9.6) 30 1.4 SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_9601| Best HMM Match : Trypsin (HMM E-Value=0) 30 1.4 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 30 1.9 SB_11317| Best HMM Match : Trypsin (HMM E-Value=3e-08) 30 1.9 SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) 30 1.9 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 30 1.9 SB_25283| Best HMM Match : LIM (HMM E-Value=1.1) 29 2.5 SB_20552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_2879| Best HMM Match : zf-C4_Topoisom (HMM E-Value=2) 29 2.5 SB_46573| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_29783| Best HMM Match : PA14 (HMM E-Value=5e-05) 29 2.5 SB_47549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_35832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_10369| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_958| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_12460| Best HMM Match : DUF1702 (HMM E-Value=5.9) 29 3.3 SB_58630| Best HMM Match : IncA (HMM E-Value=0.5) 29 4.3 SB_53550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_49165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_37756| Best HMM Match : DUF59 (HMM E-Value=6.8) 29 4.3 SB_37571| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_24040| Best HMM Match : Extensin_2 (HMM E-Value=0.009) 29 4.3 SB_18997| Best HMM Match : Fumerase_C (HMM E-Value=8.5) 29 4.3 SB_17112| Best HMM Match : Trypsin (HMM E-Value=0) 29 4.3 SB_22344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) 29 4.3 SB_11235| Best HMM Match : Trypsin (HMM E-Value=1.1e-08) 29 4.3 SB_4778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_53424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) 28 5.7 SB_44463| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32881| Best HMM Match : DUF75 (HMM E-Value=1.7) 28 5.7 SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_27922| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_16975| Best HMM Match : MFS_1 (HMM E-Value=2.6e-24) 28 5.7 SB_14515| Best HMM Match : ScdA_N (HMM E-Value=6.1) 28 5.7 SB_6892| Best HMM Match : TSP_3 (HMM E-Value=2.94273e-44) 28 5.7 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) 28 5.7 SB_50138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) 28 5.7 SB_35990| Best HMM Match : ResIII (HMM E-Value=2) 28 5.7 SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) 28 5.7 SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5) 28 5.7 SB_23533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) 28 5.7 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_8615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59466| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_58267| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=1.5) 28 7.6 SB_56271| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_44150| Best HMM Match : LIM (HMM E-Value=0.3) 28 7.6 SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) 28 7.6 SB_40687| Best HMM Match : PADR1 (HMM E-Value=0.23) 28 7.6 SB_40675| Best HMM Match : DUF572 (HMM E-Value=1.2) 28 7.6 SB_31997| Best HMM Match : zf-C2H2 (HMM E-Value=1.4013e-45) 28 7.6 SB_30355| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_20005| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 28 7.6 SB_53861| Best HMM Match : LIM (HMM E-Value=0.93) 28 7.6 SB_53507| Best HMM Match : DUF1610 (HMM E-Value=2) 28 7.6 SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) 28 7.6 SB_39998| Best HMM Match : Peptidase_C1 (HMM E-Value=0) 28 7.6 SB_23753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_19214| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_45862| Best HMM Match : GMP_synt_C (HMM E-Value=0) Length = 687 Score = 48.8 bits (111), Expect = 4e-06 Identities = 50/204 (24%), Positives = 89/204 (43%) Frame = +1 Query: 22 KMKVLSFVLLCGLALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGSLIH 201 + ++L+F+ CG R G ++ +PY +++VS G L++C G+LI Sbjct: 458 RQRLLNFLADCGRRPPMSRVIGGEAA--------RPYSWPWQVSVSM-GKLHSCGGALIS 508 Query: 202 SRWVLSAASCLQDVRFIWVRYGLVVVINPSLVTETSAVRLHPSDTIGLVSINRDVQPTDF 381 S+WV++AA C+ + F V Y ++ A L ++ + + D + + Sbjct: 509 SKWVITAAHCVIEYPFPQV-YEVIAGWGRVFEGSDEAEFLQEAELVVASNAKCDKKNGEL 567 Query: 382 ISPVALSASEDLPESGNVCGFGEVDGEPGEQLSCFDVSVVPADGLLEATSEEGQTSKYDV 561 + PV + +G G G G+ G L C + G++ S E T Y V Sbjct: 568 L-PV---DDASMVCAGGP-GRGGCQGDSGGPLVCNEAGRWVLRGIVSWGSRECSTEFYTV 622 Query: 562 GTALVSDDVQVAVLLAGADENSAG 633 T +++ + +LAG D AG Sbjct: 623 FTRVINYMPWIETILAGGDSGCAG 646 >SB_37142| Best HMM Match : Peptidase_A22B (HMM E-Value=0) Length = 1019 Score = 45.2 bits (102), Expect = 5e-05 Identities = 27/66 (40%), Positives = 36/66 (54%) Frame = +1 Query: 49 LCGLALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAAS 228 +CG++ R G + N GD P+Q LR +T+G C GSLIHS WVL+AA Sbjct: 381 VCGVSSSTSRIVGGAAANP----GDWPWQAQLR---TTTGF-PYCGGSLIHSNWVLTAAH 432 Query: 229 CLQDVR 246 C+ R Sbjct: 433 CISSKR 438 >SB_52206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 786 Score = 41.1 bits (92), Expect = 8e-04 Identities = 33/119 (27%), Positives = 59/119 (49%), Gaps = 12/119 (10%) Frame = +1 Query: 118 GDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQD-----VRFIWVRYGLVVVI 282 G+ P+QV +++ ++S L + C G++I WVL+AA C+QD ++ + L V Sbjct: 555 GEWPWQVSMKL--NSSSLPHICGGNVISPWWVLTAAHCVQDERASNIKLTMGEWRLFNVD 612 Query: 283 NPSLVTETSAVRLHPS---DTI----GLVSINRDVQPTDFISPVALSASEDLPESGNVC 438 V + H + +T+ L+ + R + T ++ PV L S D P +G +C Sbjct: 613 GTEQVIPVERIISHANYSYNTVDYDYALLKLTRPLNFTQYVQPVCLPDS-DFP-AGTLC 669 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +1 Query: 118 GDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQDVR 246 GD P+Q LR STSG C GSLIH +WVL+A C+ R Sbjct: 673 GDWPWQAQLR---STSGF-PFCGGSLIHPQWVLTATHCVSSRR 711 Score = 32.3 bits (70), Expect = 0.35 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 7/127 (5%) Frame = +1 Query: 145 RIAVSTSGLLNTCAGSLIHSRWVLSAASCL---QDVRFIWVRYGLVVVINPSLVTETSAV 315 +IA+ SG C GSL+ WV++AA C+ V G + +P +T V Sbjct: 82 QIALERSGSF-ICGGSLVSPTWVVTAAHCIAGSSHTPSYKVVTGEHIRNSPEGTEQTHDV 140 Query: 316 -RLHPSDTIGLVSINRDVQPTDFISPVALSASEDLPESGNVC---GFGEVDGEPGEQLSC 483 R+ T ++ D+ + SPV LS G+ C G+G++ PG Sbjct: 141 KRIITHPTYNSPQLSNDIALIELSSPVPLSDRGHQVSVGSKCFITGWGKI-RHPGGSHHI 199 Query: 484 FDVSVVP 504 +++P Sbjct: 200 LQQAMMP 206 >SB_20791| Best HMM Match : Trypsin (HMM E-Value=4.8e-12) Length = 227 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQDVR 246 P+Q+ LR+ + C GSLI S WVL+AA C+ +R Sbjct: 50 PWQISLRMMSKKGDDYHFCGGSLIDSEWVLTAAHCVAGIR 89 >SB_10167| Best HMM Match : Trypsin (HMM E-Value=0) Length = 532 Score = 39.5 bits (88), Expect = 0.002 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 11/128 (8%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQD-----VRFIWVRYGLVVVIN-P 288 P+Q+ LR+ +G + C GSLI WVL+AA C++D I R + Sbjct: 93 PWQISLRV----NGR-HICGGSLITPEWVLTAAHCVEDFPHPSAHRIKERSAIQQEFRLT 147 Query: 289 SLVTETSAVRLHPSDTIGLVSINRDVQPTDFISPVALSASEDLPESGNVC---GFGEV-- 453 L H + + L+ ++ +QP+D ++ V L + G C G+G + Sbjct: 148 KLFKHKDFSMSHLKNDVALLKLDNPIQPSDKVNTVCLPERNSRAQVGAQCFITGWGRLVG 207 Query: 454 DGEPGEQL 477 G+P E L Sbjct: 208 GGQPSEIL 215 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 37.1 bits (82), Expect = 0.012 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQDVR 246 P+Q LR A G C GSLIH WVL+AA CL++ + Sbjct: 272 PWQAMLRSA----GGSQFCGGSLIHPEWVLTAAHCLENTQ 307 >SB_31846| Best HMM Match : Trypsin (HMM E-Value=0) Length = 454 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 118 GDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQDVR 246 G+ P+Q L G C G+L+H WV++A+ C+ D+R Sbjct: 220 GEWPWQAMLMFQTPL-GYKQFCGGALVHEDWVVTASHCINDIR 261 >SB_4906| Best HMM Match : Trypsin (HMM E-Value=0) Length = 530 Score = 37.1 bits (82), Expect = 0.012 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQDVR 246 P+Q LR A G C GSLIH WVL+AA CL++ + Sbjct: 232 PWQAMLRSA----GGSQFCGGSLIHPEWVLTAAHCLENTQ 267 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 36.3 bits (80), Expect = 0.022 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCL 234 P+Q+ LR SG +TC GSLI RWV++AA C+ Sbjct: 118 PWQISLR---GRSGF-HTCGGSLISDRWVVTAAHCI 149 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAA 225 P+Q+ LR SG +TC GSLI RWV++AA Sbjct: 441 PWQISLR---GRSGF-HTCGGSLISDRWVVTAA 469 >SB_33775| Best HMM Match : Trypsin (HMM E-Value=0.012) Length = 115 Score = 35.1 bits (77), Expect = 0.050 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = +1 Query: 118 GDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQ 237 GD P+Q LR +TSG C GSLI +W+L+A C++ Sbjct: 20 GDWPWQAQLR---TTSGF-PYCGGSLIAPQWILTATHCVE 55 >SB_1442| Best HMM Match : SRCR (HMM E-Value=0) Length = 2103 Score = 35.1 bits (77), Expect = 0.050 Identities = 19/61 (31%), Positives = 33/61 (54%) Frame = +1 Query: 52 CGLALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASC 231 CG+ + G S + G P+QV +I T G + C GS+++S+W+++AA C Sbjct: 1770 CGIRPIVGSSLQQIVGGKVTEHGAWPWQV--QIGYKTMG--HICGGSIVNSQWIVTAAHC 1825 Query: 232 L 234 + Sbjct: 1826 V 1826 >SB_35844| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 249 Score = 34.7 bits (76), Expect = 0.066 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCL 234 P+QVHL + L+ C G+LI WV++AA C+ Sbjct: 56 PWQVHL-LQSRDGSFLHKCGGALIDREWVVTAAHCV 90 >SB_32296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 34.7 bits (76), Expect = 0.066 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 8/95 (8%) Frame = +1 Query: 358 RDVQPTDFISPVALSASEDLPESGNVCGF-GEVDGEP--GEQLSCFDVSVV----PADGL 516 RD+ I+ + D+ E G+VC G DG P G + + + V PA+ L Sbjct: 101 RDLGGAGVIALKPVMRGPDINEDGSVCAAAGARDGRPRYGRYVRRYGLFTVVGKAPAEPL 160 Query: 517 LEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 T EEG+ S++ +G +LV Q+AV L G D Sbjct: 161 APITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 194 >SB_17890| Best HMM Match : Trypsin (HMM E-Value=3.2) Length = 157 Score = 34.7 bits (76), Expect = 0.066 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +1 Query: 181 CAGSLIHSRWVLSAASCLQDVR 246 CAGSLI +RW+++A C +D R Sbjct: 79 CAGSLIEARWIITAGHCFKDPR 100 >SB_10942| Best HMM Match : PDZ (HMM E-Value=2.3e-08) Length = 386 Score = 34.7 bits (76), Expect = 0.066 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCL 234 P+Q LR +TSG C GSLIH +W+L+A C+ Sbjct: 66 PWQAQLR---TTSGF-PYCGGSLIHPQWILTATHCV 97 >SB_50961| Best HMM Match : Trypsin (HMM E-Value=0) Length = 1007 Score = 34.3 bits (75), Expect = 0.087 Identities = 20/62 (32%), Positives = 33/62 (53%) Frame = +1 Query: 49 LCGLALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAAS 228 +CG+ GR G Q+ + D P+Q L+ + + + C GSLI+ WV++AA Sbjct: 423 ICGVRNALGRIVGGQTAK----VEDWPWQAGLKKGLDDTIV---CGGSLINREWVVTAAH 475 Query: 229 CL 234 C+ Sbjct: 476 CI 477 >SB_26181| Best HMM Match : DUF963 (HMM E-Value=0.00098) Length = 620 Score = 34.3 bits (75), Expect = 0.087 Identities = 33/99 (33%), Positives = 43/99 (43%), Gaps = 1/99 (1%) Frame = +2 Query: 281 LTRPWSRRLAQSVCTPRIPLVSSASTGMSNPLTSSLPWLCLPARTYPNP-EMSAALAKST 457 LT P S + S T PL SS+ S+PLTSS P T P+P S+ L S+ Sbjct: 185 LTSP-SPLTSPSPLTSSSPLTSSSPLTSSSPLTSSSPLTSSSPLTSPSPLTSSSPLTSSS 243 Query: 458 ANLESN*AASTCPWCPPTVSLRPPARKARLPSTMLELLL 574 S+ S+ P P+ L P+ L LLL Sbjct: 244 PLTSSSPLTSSSPLTSPS-PLTSPSPLTXXXXLHLRLLL 281 >SB_31648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 656 Score = 33.9 bits (74), Expect = 0.12 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 14/120 (11%) Frame = +1 Query: 115 LGDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCL--QDVRFIWVRYGLV---VV 279 LG+ P+Q L V+ G + C GSLI +WVL+A C+ +D V G V Sbjct: 70 LGEWPWQAWLH--VTPHGFV--CGGSLIAPQWVLTAGHCILTEDPEKYRVVLGDVDRDTT 125 Query: 280 INPSLVTETSAVRLHP--------SDTIGLVSINRDVQPTDFISPVALSASED-LPESGN 432 + + HP + + L+ ++R T F++ V L A E+ +PE N Sbjct: 126 EGSEQIFHVRRIIKHPHYSRDVPYDNDVALLQLSRPAFVTSFVNTVCLPAQEEKVPEDRN 185 >SB_55505| Best HMM Match : Trypsin (HMM E-Value=0) Length = 292 Score = 33.5 bits (73), Expect = 0.15 Identities = 30/132 (22%), Positives = 51/132 (38%), Gaps = 3/132 (2%) Frame = +1 Query: 52 CGLALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASC 231 CG V S+ + ++ + H + C GSL+ W+++AA C Sbjct: 23 CGKRFVPPSSSTASACRRIMGGQRSTIEQHPWMVAMMLDSAQACGGSLVPEDWIVTAAHC 82 Query: 232 LQDVRFIW-VRYGLVVVINPSLVTETSAVRLHPSDTIGLVSINRDVQPTDF-ISPVALSA 405 R W V G + T SA+ HP + S+ + P D+ ++ V L Sbjct: 83 FDSNRLRWRVVAGNDMPSKAVNTTGVSAIWRHPQYKSNIASL--ESGPCDYDVALVKLEK 140 Query: 406 S-EDLPESGNVC 438 S P++ +C Sbjct: 141 SVATTPKTVPIC 152 >SB_48467| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-21) Length = 418 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +1 Query: 112 ALGDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQD 240 A+G+ P+QV L + C G+L+ S WVL+AA C +D Sbjct: 265 AVGEWPWQVSLYLTHYGP----VCGGTLLTSEWVLTAARCFRD 303 >SB_21575| Best HMM Match : Trypsin (HMM E-Value=0) Length = 696 Score = 33.1 bits (72), Expect = 0.20 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Frame = +1 Query: 22 KMKVLSFVLLCGLALVQGRSTGVQSTNALVALGD--KPYQVHLRIAVSTSGLLNTCAGSL 195 K+ V+ V G + V + G + A V G +P+ +I++ G ++C G+L Sbjct: 2 KIVVVLLVACLGPSFVDA-ACGRKPPGARVINGQNAQPHSWPWQISLRPYGRYHSCGGTL 60 Query: 196 IHSRWVLSAASCL 234 I RWV++A+ C+ Sbjct: 61 ISDRWVVTASHCV 73 >SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) Length = 1575 Score = 33.1 bits (72), Expect = 0.20 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 11/98 (11%) Frame = +1 Query: 358 RDVQPTDFISPVALSASEDLPESGNVCGFGEVDG---------EPGEQLSCF-DVSVVPA 507 RD+ I+P + D+ + G+VC + +P + F DV PA Sbjct: 663 RDLGGAGVIAPKPVMRGTDIDDDGSVCESLRANAVLPPVLEMVDPDRRYRLFTDVVKAPA 722 Query: 508 DGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 + L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 723 EPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 759 >SB_21521| Best HMM Match : Trypsin (HMM E-Value=1.7e-23) Length = 299 Score = 32.7 bits (71), Expect = 0.27 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 3/70 (4%) Frame = +1 Query: 34 LSFVL-LCGLALVQGRSTGVQSTNALVALGDK--PYQVHLRIAVSTSGLLNTCAGSLIHS 204 ++FVL + G+A + S G + + GD+ P+ ++++ G + C GSL+ Sbjct: 5 IAFVLCVLGVAPSEASSCGRRPDGVRIVGGDEAVPHSWPWQVSIRLKGS-HICGGSLLSP 63 Query: 205 RWVLSAASCL 234 W+L+AA C+ Sbjct: 64 LWLLTAAHCV 73 >SB_44747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 32.3 bits (70), Expect = 0.35 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = +1 Query: 181 CAGSLIHSRWVLSAASCLQ 237 C+G+L+ RWV++AASCL+ Sbjct: 52 CSGALVSPRWVVTAASCLK 70 >SB_30267| Best HMM Match : Trypsin (HMM E-Value=0) Length = 282 Score = 32.3 bits (70), Expect = 0.35 Identities = 22/61 (36%), Positives = 32/61 (52%) Frame = +1 Query: 52 CGLALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASC 231 CG A V + + AL LG+ P+Q L + +G + C GSL+ WVL+AA C Sbjct: 22 CGRAEVPATRV-ISGSEAL--LGEWPWQAWLHL--QHTGFI--CGGSLVAPGWVLTAAHC 74 Query: 232 L 234 + Sbjct: 75 I 75 >SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 32.3 bits (70), Expect = 0.35 Identities = 22/64 (34%), Positives = 32/64 (50%) Frame = +1 Query: 43 VLLCGLALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSA 222 V L G + S + T A A D P+Q + I V S + C G+LI + WV++A Sbjct: 271 VTLSGFTSEEPMSRIIGGTTA--APHDWPWQAQILIHVDKSWN-HRCGGTLIDTEWVVTA 327 Query: 223 ASCL 234 A C+ Sbjct: 328 AHCV 331 >SB_11021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 32.3 bits (70), Expect = 0.35 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 124 KPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQD 240 +P+ +I++ + C G+LI RWV++A+ C+ D Sbjct: 853 QPHSWPWQISLRQGRRFHLCGGALISDRWVVTASHCIHD 891 >SB_6689| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) Length = 514 Score = 32.3 bits (70), Expect = 0.35 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = +1 Query: 358 RDVQPTDFISPVALSASEDLPESGNVCGFGEVDG-EPGEQLSCFDV-SVVPADGLLEATS 531 RD+ T I+ + D+ + G+VC E++ +P + F V PA+ L+ T Sbjct: 112 RDLGGTGVIALKPVVRGPDINDDGSVCASAELEMVDPDRRYRLFTVVGKAPAEPLVPITE 171 Query: 532 EEGQTSKYDVG 564 EEG++ VG Sbjct: 172 EEGRSEHKIVG 182 >SB_50121| Best HMM Match : DoxX (HMM E-Value=1.6) Length = 338 Score = 31.9 bits (69), Expect = 0.47 Identities = 24/91 (26%), Positives = 33/91 (36%) Frame = +2 Query: 284 TRPWSRRLAQSVCTPRIPLVSSASTGMSNPLTSSLPWLCLPARTYPNPEMSAALAKSTAN 463 T P R +S+ S T +PLT + L + N E+ A + Sbjct: 58 TLPAGHRTTESIMETINHAKSQILTAKLDPLTGKIV-LVFTGIVFLNAELCALFGLEAKD 116 Query: 464 LESN*AASTCPWCPPTVSLRPPARKARLPST 556 + AS CPW P +S PP ST Sbjct: 117 DQMGGRASYCPWGIPHLSAHPPQTPTAPAST 147 >SB_48048| Best HMM Match : Trypsin (HMM E-Value=3.64338e-44) Length = 348 Score = 31.9 bits (69), Expect = 0.47 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 118 GDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASC 231 G P+QV + + + C G+LI+ WVL+AA C Sbjct: 136 GTWPWQVGIYRFDHSGNQMQICGGALINREWVLTAAHC 173 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 31.9 bits (69), Expect = 0.47 Identities = 21/58 (36%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -3 Query: 178 C*ADHWSKQRCVDGPGRA-CLRGQPGRWYFAHRCCAPVPEQDRTIVQKIEPSSCERVR 8 C H S C GP + CLR PG YF H C PE T V + + R R Sbjct: 964 CKPCHVSCNAC-RGPAKGDCLRCNPGHVYFKHTCVTECPE--GTFVDDSDGADARRCR 1018 >SB_22688| Best HMM Match : Ribosomal_L21p (HMM E-Value=1.7) Length = 109 Score = 31.9 bits (69), Expect = 0.47 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -1 Query: 630 SAVLVSTGQEHSYLNIIADKSSSNIVLGSLAFLAGGLKETVGGHHG 493 S ++ S G+E Y ++ D +S+ V+G L F+ + GH+G Sbjct: 45 STIIKSQGEEDKYTRLLYDNNSTRTVIGYLVFIT--FPYCLSGHYG 88 >SB_59013| Best HMM Match : DoxX (HMM E-Value=1.6) Length = 338 Score = 31.9 bits (69), Expect = 0.47 Identities = 24/91 (26%), Positives = 33/91 (36%) Frame = +2 Query: 284 TRPWSRRLAQSVCTPRIPLVSSASTGMSNPLTSSLPWLCLPARTYPNPEMSAALAKSTAN 463 T P R +S+ S T +PLT + L + N E+ A + Sbjct: 58 TLPAGHRTTESIMETINHAKSQILTAKLDPLTGKIV-LVFTGIVFLNAELCALFGLEAKD 116 Query: 464 LESN*AASTCPWCPPTVSLRPPARKARLPST 556 + AS CPW P +S PP ST Sbjct: 117 DQMGGRASYCPWGIPHLSAHPPQTPTAPAST 147 >SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 898 Score = 31.5 bits (68), Expect = 0.62 Identities = 51/198 (25%), Positives = 76/198 (38%), Gaps = 16/198 (8%) Frame = +1 Query: 13 LSRKMKVLSFVLLCGLALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGS 192 LS K L V CG G S V NA P+Q+ LR+ +G + C GS Sbjct: 9 LSLSTKALLEVRACGKR-PYGTSRVVNGDNA--QQHSWPWQISLRV----NGR-HICGGS 60 Query: 193 LIHSRWVLSAASCLQD---------VRFIWVRYGLVVVIN----PSLVTETSAVRLHPSD 333 LI WV++AA C+ V R G V N L H + Sbjct: 61 LIAKDWVVTAAHCVDRNPTPSGYTVVVGAHHRTGNTPVQNTFRLKQLFKHEQFSMRHLKN 120 Query: 334 TIGLVSINRDVQPTDFISPVALSASEDLPESGNVC---GFGEVDGEPGEQLSCFDVSVVP 504 I L+ ++ V+ +D ++ V L +S ++G C G+G G G +++P Sbjct: 121 DIALLQLHEPVKASDKVNTVCLPSSGSRAQAGARCYITGWGRTVG-GGSAAGILQQAMLP 179 Query: 505 ADGLLEATSEEGQTSKYD 558 G + G+ D Sbjct: 180 VAGDSDCQRTNGRLVPVD 197 >SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 31.5 bits (68), Expect = 0.62 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +1 Query: 181 CAGSLIHSRWVLSAASCLQDVRF--IWVRYG 267 C G+L+H RWV++A+ C+ + ++VR G Sbjct: 275 CGGTLVHPRWVVTASHCVHKLTTGDLYVRMG 305 >SB_26443| Best HMM Match : Trypsin (HMM E-Value=3e-22) Length = 231 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCL 234 P+Q+ LR T+G + C GSLI WVL+AA C+ Sbjct: 50 PWQISLR----TNGQ-HICGGSLITPEWVLTAAHCV 80 >SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) Length = 718 Score = 31.5 bits (68), Expect = 0.62 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +1 Query: 139 HLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQDVRFIWV 258 H ++ + +G + C GSLI +WV+++ C + ++ Sbjct: 547 HAQVDLVVNGTRHNCGGSLIDKQWVVTSGHCFDQRPYAYI 586 >SB_36638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 30.7 bits (66), Expect = 1.1 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 25/122 (20%) Frame = +1 Query: 181 CAGSLIHSRWVLSAASC--------LQDVRFIWVRYGLVVVINPS----LVTETSAVRLH 324 C GSLI +WVL+AA C L RF V+ GL P+ + S +R H Sbjct: 133 CGGSLISEKWVLTAAHCVTHRNGNILPRSRF-QVQLGLYRTTLPNEPQVQLRNISEIRTH 191 Query: 325 P-------SDTIGLVSINRDVQPTDFISPVALSASEDL------PESGNVCGFGEVDGEP 465 P + L+ ++ + ++++ P+ L ++D + G G+G+ G Sbjct: 192 PQFDHVLFDADLALIKLDGEAIISEYVRPICLPETDDQASLISPSKFGMAVGWGKTVGRQ 251 Query: 466 GE 471 G+ Sbjct: 252 GD 253 >SB_32455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 18 SQDEGSIFCTIVRSCSGTGAQH--RCAKYQRPGCPRRQA 128 S+D +++C+IVR S T QH C + P PR+ A Sbjct: 692 SEDLVTVYCSIVRQPSSTPLQHGPHCRSFVSPEFPRKLA 730 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.7 bits (66), Expect = 1.1 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +1 Query: 181 CAGSLIHSRWVLSAASCL 234 C G+L+H +WV++AA C+ Sbjct: 166 CGGTLVHPQWVITAAHCV 183 >SB_29414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 151 AVSTSGLLNTCAGSLIHSRWVLSAASC 231 A+ +G + C GS+I S+WV++AA C Sbjct: 43 ALFLNGTHHRCGGSVIKSQWVVTAAHC 69 >SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 30.3 bits (65), Expect = 1.4 Identities = 23/59 (38%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +1 Query: 445 GEVDGEPGEQLSCFDVSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 G DG P L V PA+ L T EEG++ VG +LV Q+AV L G D Sbjct: 235 GARDGRPRPALRTLHVRWSPAEPLAPITEEEGRSEHKIVG-SLVKRGDQIAVGALEGID 292 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 539 PSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQT 432 PS+ PSA +T ++ C+P +PST P T Sbjct: 57 PSTPCTHSTPSAPSTPSTPSTPCTPSTPSTPSTPST 92 >SB_6828| Best HMM Match : Spo0M (HMM E-Value=9.6) Length = 220 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+T +Y +G +LV Q+AV L G D Sbjct: 95 VGKAPAEPLAPITEEEGRT-EYKIGGSLVKRGDQIAVGALEGID 137 >SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = -1 Query: 318 TDCASLRDQGRVNYHHQTITD--PDETDILEAASGAEDPARVNEGTGAGVEQTTGRNSDA 145 +D +S RD+ R + H+ +TD P D A S D A N+GT Q++ + A Sbjct: 807 SDSSSSRDRKRKHRHNDDVTDKKPRLVDYSSADSSDHDNAADNKGTEPRTSQSSATKNRA 866 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 118 GDKPYQVHLRIAVSTSGLLNT--CAGSLIHSRWVLSAASCL 234 G P+QV L S NT C G+LI WVL+AA C+ Sbjct: 1170 GGYPWQVALEFDTFQSNY-NTFHCGGTLIAEDWVLTAAHCV 1209 >SB_9601| Best HMM Match : Trypsin (HMM E-Value=0) Length = 285 Score = 30.3 bits (65), Expect = 1.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 181 CAGSLIHSRWVLSAASC 231 C G+L+H RWV++ A C Sbjct: 54 CGGALVHERWVVTGAHC 70 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQDVRFIWV 258 P+QV L + +G + C GSLI +WV+++ C + ++ Sbjct: 262 PWQVDLVV----NGTRHNCGGSLIDKQWVVTSGHCFDQRPYAYI 301 >SB_11317| Best HMM Match : Trypsin (HMM E-Value=3e-08) Length = 153 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCL 234 P+Q LR S SG C G+L+H R+V++A+ C+ Sbjct: 36 PWQAQLR---SASGF-PFCGGTLVHPRFVVTASHCI 67 >SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) Length = 965 Score = 29.9 bits (64), Expect = 1.9 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = -2 Query: 509 SAGTTDTSKQLSCSPGSPSTS-----PKPQTFPDSGRSSLADKATGEMKSVGWTSLLMLT 345 SAG TDTS+Q + + S S P+P+ FP G S + + +S + + + Sbjct: 554 SAGYTDTSRQFASADRSTVISAEYNDPRPRYFPTQGLSDSSPVESHGRQSTFFENKSLTA 613 Query: 344 RPMVSEGCRRT 312 R ++G R T Sbjct: 614 RAFENKGWRGT 624 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 181 CAGSLIHSRWVLSAASCL 234 C GSL+ S WVL+AA C+ Sbjct: 340 CGGSLLSSTWVLTAAHCV 357 >SB_25283| Best HMM Match : LIM (HMM E-Value=1.1) Length = 1097 Score = 29.5 bits (63), Expect = 2.5 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV + Q+AV L G D Sbjct: 84 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKREDQIAVGALEGID 137 >SB_20552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 130 RACLRGQPGRWYFAHRCCAP 71 +AC+ G PGR F+H C P Sbjct: 158 QACINGDPGRLSFSHAPCVP 177 >SB_2879| Best HMM Match : zf-C4_Topoisom (HMM E-Value=2) Length = 610 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 + + PAD L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 146 LEMAPADPLAPITEEEGR-SEHKIGGSLVKRGGQIAVGALEGID 188 >SB_46573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 181 CAGSLIHSRWVLSAASCL 234 C GSLI WVL+AA CL Sbjct: 57 CGGSLIDPGWVLTAAHCL 74 >SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 620 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 145 RIAVSTSGLLNTCAGSLIHSRWVLSAASCL 234 +IA+ + G C GSL+ S WV++AA C+ Sbjct: 491 QIALKSRGNF-ICGGSLVSSTWVVTAAHCV 519 >SB_29783| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1395 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 451 VDGEPGEQLSCFDVSVVPADGLLEATSEEGQ 543 V G+ GE++ + V VVP DG+L EG+ Sbjct: 1195 VPGKRGEKVDAYKVPVVPLDGVLNGHPLEGK 1225 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 658 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 700 >SB_47549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/43 (48%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -2 Query: 497 TDTSKQLSCSPGSPS--TSPKPQTFPDSGRSSLADKATGEMKS 375 +DTSKQ SP SPS T+P P +F D RS A A E S Sbjct: 146 SDTSKQTVPSPLSPSKATTPLPLSFDDFMRSK-ATAAQQEFNS 187 >SB_35832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +PG++ F V PA+ L T EEG++ VG+ + D QVAV L G D Sbjct: 158 DPGQRYRLFTVIGKAPAEPLAPITEEEGRSEHRIVGSLIKRGD-QVAVGALEGID 211 >SB_10369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 29.1 bits (62), Expect = 3.3 Identities = 20/75 (26%), Positives = 28/75 (37%) Frame = +2 Query: 284 TRPWSRRLAQSVCTPRIPLVSSASTGMSNPLTSSLPWLCLPARTYPNPEMSAALAKSTAN 463 T P A+S+ S T +PLT + L + N E+ A + Sbjct: 58 TLPAGHHTAESIVETINHAKSQILTAKQDPLTGKIV-LVSTGVVFLNAELCALFGLEAKD 116 Query: 464 LESN*AASTCPWCPP 508 + AS CPW PP Sbjct: 117 DQMGERASQCPWGPP 131 >SB_958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ SK+ +G +LV Q+AV L G D Sbjct: 98 VGKAPAEPLAPITEEEGR-SKHKIGGSLVKRADQIAVGALEGID 140 >SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1864 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +1 Query: 145 RIAVSTSGL-LNTCAGSLIHSRWVLSAASC 231 ++A++ SG + C G+LI + WVL+AA C Sbjct: 1253 QVALTLSGNPVQRCGGALIAADWVLTAAHC 1282 >SB_12460| Best HMM Match : DUF1702 (HMM E-Value=5.9) Length = 255 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +PG++ F V PA+ L T EEG++ VG+ + D QVAV L G D Sbjct: 158 DPGQRYRLFTVIGKAPAEPLAPITEEEGRSEHRIVGSLIKRGD-QVAVGALEGID 211 >SB_58630| Best HMM Match : IncA (HMM E-Value=0.5) Length = 307 Score = 28.7 bits (61), Expect = 4.3 Identities = 23/91 (25%), Positives = 32/91 (35%) Frame = +2 Query: 284 TRPWSRRLAQSVCTPRIPLVSSASTGMSNPLTSSLPWLCLPARTYPNPEMSAALAKSTAN 463 T P A+S+ S T +PLT + L + N E+ A + Sbjct: 25 TLPAGHHTAESIVETINHAKSQILTAKQDPLTGKIV-LVSTGVVFLNAELCALFGLEAKD 83 Query: 464 LESN*AASTCPWCPPTVSLRPPARKARLPST 556 + AS PW P +S PP ST Sbjct: 84 DQMGSGASQYPWGSPHLSAHPPQTPTAPAST 114 >SB_53550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 150 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHTIGGSLVKRSDQIAVGALEGID 203 >SB_49165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 643 ARRFQRCSRQHRPGAQLLEHHR*QEQFQHRTWKSGLPRWWPQG 515 ++ + R SR R G L E +R + Q H T+ +PRW P G Sbjct: 562 SKHYDRLSR--RVGGILEERNRNRYQNGHLTYPYLMPRWLPNG 602 >SB_37756| Best HMM Match : DUF59 (HMM E-Value=6.8) Length = 225 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 161 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKKGDQIAVGALEGID 214 >SB_37571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 460 EPGEQLSCFDVSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 193 DPDRRYGLSVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 245 >SB_24040| Best HMM Match : Extensin_2 (HMM E-Value=0.009) Length = 530 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/69 (23%), Positives = 29/69 (42%) Frame = +2 Query: 176 TPAPVPSFTLAGSSAPLAAXXXXXXXXXXXXXXXXLTRPWSRRLAQSVCTPRIPLVSSAS 355 T AP+P+ ++ +SAP+ +T ++ V + IP++S Sbjct: 340 TSAPIPTISMGVTSAPIPIISMGVTSAFIPIISMGVTSAPFPIISMGVTSAPIPIISMGV 399 Query: 356 TGMSNPLTS 382 T S P+ S Sbjct: 400 TSASIPIIS 408 >SB_18997| Best HMM Match : Fumerase_C (HMM E-Value=8.5) Length = 419 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 460 EPGEQLSCFDVSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 3 DPDRRYGLSVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 55 >SB_17112| Best HMM Match : Trypsin (HMM E-Value=0) Length = 636 Score = 28.7 bits (61), Expect = 4.3 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 181 CAGSLIHSRWVLSAASCLQDVR 246 C G+L+ +WV++AA C+ V+ Sbjct: 377 CGGTLVSPQWVVTAAHCVDHVK 398 >SB_22344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGADENSAG 633 V PA+ L T EEG+ S++ +G +LV Q+ V L G D +G Sbjct: 136 VGTAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQITVGALKGMDAGISG 183 >SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 28.7 bits (61), Expect = 4.3 Identities = 24/89 (26%), Positives = 39/89 (43%) Frame = -2 Query: 539 PSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTS 360 P + AS +A T T+ + +P + +T+P+ T P++ +SLA A T+ Sbjct: 671 PEATTASLLTTAPETTTASLATTAPEA-TTAPEATTAPEATTASLATTA-----PEATTA 724 Query: 359 LLMLTRPMVSEGCRRTALVSVTRDGLITT 273 L T P + T T L+TT Sbjct: 725 SLATTAPETTTASLATTAPETTTASLVTT 753 >SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) Length = 610 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 60 CSGTGAQHRCAKYQRPGCPRRQALPGPSTHRCFDQW 167 CS Q A+ Q P C +AL PSTH+ F Q+ Sbjct: 90 CSNCFTQGLNARDQSPRCITCRALAAPSTHKDFLQY 125 >SB_11235| Best HMM Match : Trypsin (HMM E-Value=1.1e-08) Length = 235 Score = 28.7 bits (61), Expect = 4.3 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 12/120 (10%) Frame = +1 Query: 127 PYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQ---DVRFIWVRYGLVVVINP--S 291 P+Q+ LR+ S + C SL+ W L+AA C+Q + + G +N + Sbjct: 98 PWQLSLRVYGS-----HNCGASLLSPGWALTAAHCVQRSSNPADYTLAAGAHRRVNDAHA 152 Query: 292 LVTETSAVRLHPSDTIG-------LVSINRDVQPTDFISPVALSASEDLPESGNVCGFGE 450 V S V H ++G L+ ++ VQ +D I + L A D +G C E Sbjct: 153 QVLRVSQVISHKEFSMGHLRNDVTLLRLSAPVQLSDKIGTICLPAHGDRAPAGGHCYISE 212 >SB_4778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 118 GDKPYQVHLRIAVSTSGLLNTCAGSLIHSRWVLSAASCLQD 240 G P+QV L + SG C G+L+ WV++AA C+ D Sbjct: 640 GAWPWQVML---IYNSGR-QFCGGTLVTPEWVITAAHCVVD 676 >SB_53424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 3 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 56 >SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) Length = 486 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 467 PGSPSTSPK--PQTFPDSGRSSLADKATGEMKSVG 369 P S ++SP P+ P S S +K +GE KSVG Sbjct: 91 PSSNTSSPNLHPEFIPLSSEKSQENKPSGEFKSVG 125 >SB_44463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 69 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 122 >SB_32881| Best HMM Match : DUF75 (HMM E-Value=1.7) Length = 462 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 161 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 214 >SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 98 DPDRRYGLFTVVDEAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 151 >SB_27922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1704 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +1 Query: 34 LSFVLLCGLALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGSLI 198 LSF + + ++ + S N+ +AL D+P H R+ VS + +N S+I Sbjct: 830 LSFYSITCIGRLRAAKIEMDSVNS-IALSDQPQDTHARLLVSANIGINASGQSVI 883 >SB_16975| Best HMM Match : MFS_1 (HMM E-Value=2.6e-24) Length = 1193 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 927 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 980 >SB_14515| Best HMM Match : ScdA_N (HMM E-Value=6.1) Length = 609 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 161 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 214 >SB_6892| Best HMM Match : TSP_3 (HMM E-Value=2.94273e-44) Length = 749 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 424 SGNVCGFGE-VDGEPGEQLSCFDVSVVPADGLLEATSEEGQTSKYDVGTALVSDD 585 +G CG E +DG P ++L C++ S + L S + T VG A DD Sbjct: 329 NGIECGQDEDLDGFPDKKLPCYEASCQGDNCPLTPNSGQEDTDSDGVGDACDDDD 383 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 494 PWCPPTVSLRPPARKA 541 PWCPP + L P RKA Sbjct: 312 PWCPPCMRLLPEYRKA 327 >SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 533 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 3 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 56 >SB_50138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 481 CFDVSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 C V PA+ L T EEG+ S++ +G + V Q+AV L G D Sbjct: 161 CTVVCKAPAESLAPITEEEGR-SEHKIGGSFVKRGDQIAVGALEGID 206 >SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) Length = 840 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 113 DPDRRYGLFTVVGKAPAEPLAPLTEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 166 >SB_35990| Best HMM Match : ResIII (HMM E-Value=2) Length = 798 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 125 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 178 >SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 1053 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 131 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 184 >SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 69 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 122 >SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5) Length = 452 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 135 DPDRRYGLFTVVGKAPAEPLAPITGEEGR-SEHKIGGSLVKRGDQIAVGALEGID 188 >SB_23533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 817 Score = 28.3 bits (60), Expect = 5.7 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +1 Query: 358 RDVQPTDFISPVALSASEDLPESGNVCGFGEVDGEPGEQLSCFDVSVVPADGLLEATSEE 537 RD+ I+P + D+ + G+VC +LS V PA+ L T EE Sbjct: 110 RDLGEAGVIAPKPVMRGSDINDGGSVC----------VRLSTV-VGEAPAEPLAPITEEE 158 Query: 538 GQTSKYDVGTALVSDDVQVAV-LLAGAD 618 G+ S+ +G +LV Q+A L G D Sbjct: 159 GR-SEQKIGGSLVKRGDQIAAGALEGID 185 >SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) Length = 659 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 512 PSAGTTDTSKQLSCSPGSPSTSPKPQTFP 426 P TT T Q S SP P+TS +PQT P Sbjct: 244 PIGPTTSTQHQTS-SPIGPTTSTQPQTSP 271 Score = 27.9 bits (59), Expect = 7.6 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = -2 Query: 509 SAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTSLLMLTRPMVS 330 + G T ++K SP P+TS +PQT G ++ T +VG T+ T+P S Sbjct: 90 AVGHTTSTKPQKSSPIGPTTSTQPQTSSTVGHTTSTQPQTS--STVGHTT---STKPQTS 144 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 494 PWCPPTVSLRPPARK-ARLPSTMLEL 568 PWCPPT S ARK ++PS EL Sbjct: 645 PWCPPTSSSPGVARKYYQVPSATSEL 670 >SB_8615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 223 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 460 EPGEQLSCFDV-SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 +P + F V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 157 DPDRRYGLFTVVGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 210 >SB_59466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 647 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 493 SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 S+ PA+ L T EEG+ S+ +G +LV Q+AV L G D Sbjct: 282 SLAPAEPLAPITEEEGR-SERRIGGSLVKSGDQIAVGALEGID 323 >SB_58267| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=1.5) Length = 722 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 458 PSTSPKPQTFPDSGRSSLADKATGEMK 378 P SP +T DS +SSL ++ G+M+ Sbjct: 111 PWNSPPQETIRDSSKSSLVSRSEGQMR 137 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 458 PSTSPKPQTFPDSGRSSLADKATGEMK 378 P SP +T DS +SSL ++ G+M+ Sbjct: 382 PWNSPPQETIRDSSKSSLVSRSEGQMR 408 >SB_56271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 172 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 214 >SB_44150| Best HMM Match : LIM (HMM E-Value=0.3) Length = 772 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 198 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 240 >SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1433 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 424 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 466 >SB_40687| Best HMM Match : PADR1 (HMM E-Value=0.23) Length = 733 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 493 SVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 S+ PA+ L T EEG+ S+ +G +LV Q+AV L G D Sbjct: 178 SLAPAEPLAPITEEEGR-SERRIGGSLVKSGDQIAVGALEGID 219 >SB_40675| Best HMM Match : DUF572 (HMM E-Value=1.2) Length = 929 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 458 PSTSPKPQTFPDSGRSSLADKATGEMK 378 P SP +T DS +SSL ++ G+M+ Sbjct: 825 PWNSPPQETIRDSSKSSLVSRSEGQMR 851 >SB_31997| Best HMM Match : zf-C2H2 (HMM E-Value=1.4013e-45) Length = 1091 Score = 27.9 bits (59), Expect = 7.6 Identities = 20/63 (31%), Positives = 31/63 (49%) Frame = +1 Query: 412 DLPESGNVCGFGEVDGEPGEQLSCFDVSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQ 591 D PE GN +V G+P LS DV+ + L S+E Q+ ++ A++ +Q Sbjct: 330 DEPEEGNETPTAQVAGKPSSALSVDDVAGM-LQSLTGKISDESQSRAKEL--AVIQGRIQ 386 Query: 592 VAV 600 AV Sbjct: 387 KAV 389 >SB_30355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 172 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 214 >SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 102 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 144 >SB_20005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 135 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 177 >SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2317 Score = 27.9 bits (59), Expect = 7.6 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 5/72 (6%) Frame = +2 Query: 323 TPRIPLVSSASTGMSNPLTSSLPWLCLPARTYPNPEMSA-----ALAKSTANLESN*AAS 487 T +P +SA + P T++LP T PE +A AL K+TA E+ A Sbjct: 200 TTSVPETTSAPENTALPKTTALPETTAAPETIAKPETTAPPETTALPKTTAVPETTAAPE 259 Query: 488 TCPWCPPTVSLR 523 T P T LR Sbjct: 260 TTA-KPETTDLR 270 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 404 PARTYPNPEMSAAL-AKSTANLESN*AASTCPWCPPTVSLRPPARKA 541 P P P S L A +T NL +CP CPP V + P A K+ Sbjct: 265 PVTCPPCPASSGCLVAAATGNLTVTLVPPSCPPCPPPV-ICPKAPKS 310 >SB_53861| Best HMM Match : LIM (HMM E-Value=0.93) Length = 968 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 + + PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 157 LEMAPAETLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 199 >SB_53507| Best HMM Match : DUF1610 (HMM E-Value=2) Length = 425 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 14 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 56 >SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) Length = 315 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 85 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 127 >SB_39998| Best HMM Match : Peptidase_C1 (HMM E-Value=0) Length = 1220 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 376 VGKAPAEPLATITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 418 >SB_23753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 517 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 536 SSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDS 420 +S AS + TT T+ S P +PS+SP T P S Sbjct: 363 TSTTASSVATTVTTTTATSSSMLPNTPSSSPSTGTQPSS 401 >SB_19214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 172 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 214 >SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1030 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 490 VSVVPADGLLEATSEEGQTSKYDVGTALVSDDVQVAV-LLAGAD 618 V PA+ L T EEG+ S++ +G +LV Q+AV L G D Sbjct: 172 VGKAPAEPLAPITEEEGR-SEHKIGGSLVKRGDQIAVGALEGID 214 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.134 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,769,112 Number of Sequences: 59808 Number of extensions: 562972 Number of successful extensions: 3305 Number of sequences better than 10.0: 118 Number of HSP's better than 10.0 without gapping: 2703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3254 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -