BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10m13r (514 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_11291| Best HMM Match : LSM (HMM E-Value=6.5e-11) 49 2e-06 SB_38094| Best HMM Match : LSM (HMM E-Value=0.0077) 34 0.060 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 30 1.3 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 30 1.3 SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063) 30 1.3 SB_51867| Best HMM Match : TP2 (HMM E-Value=9.2) 28 5.2 SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 27 9.1 SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) 27 9.1 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 63.3 bits (147), Expect = 1e-10 Identities = 30/98 (30%), Positives = 56/98 (57%), Gaps = 2/98 (2%) Frame = -2 Query: 411 LPLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYI 232 +P+ +L A+ H + +E NGE Y G L+ ++ MN + + T+RDG + ++ + ++ Sbjct: 5 VPIKILHEAEGHVITLETLNGEVYRGKLIEAEDNMNCQMSNITVTARDG-RVSQLEQVFV 63 Query: 231 RGSTIKYLRIPDEV--IDMVKEETQVKARGRNEVSKGR 124 RGS I++L +PD + M K+ TQ + G +G+ Sbjct: 64 RGSKIRFLILPDMLKNAPMFKKMTQKGSSGTGAAGRGK 101 >SB_11291| Best HMM Match : LSM (HMM E-Value=6.5e-11) Length = 114 Score = 49.2 bits (112), Expect = 2e-06 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 2/94 (2%) Frame = -2 Query: 399 LLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGST 220 L++ Q + VEL+N G + D +MNI +++V G+ +P ++ G+ Sbjct: 16 LIKAVQGYNTTVELRNESYLEGFIEHVDGFMNIKMKDVKFVKASGE-VDNLPAMFVVGTQ 74 Query: 219 IKYLRIPDEVIDMVK--EETQVKARGRNEVSKGR 124 I+Y+ IPDE IDM K E+ K +G V + R Sbjct: 75 IRYVHIPDE-IDMRKAIEQELGKIQGTRTVKRER 107 >SB_38094| Best HMM Match : LSM (HMM E-Value=0.0077) Length = 43 Score = 34.3 bits (75), Expect = 0.060 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 408 PLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNI 301 P L + P++++LK G Y G+LVS D +MN+ Sbjct: 7 PKPFLNSLTGKPVIIKLKWGMEYKGYLVSVDGYMNL 42 >SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 764 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 5/37 (13%) Frame = +2 Query: 122 PRPLETSLRPRALTC-----VSSFTMSMTSSGILKYL 217 P+ +ET +RP +LTC + FT+S + GI+++L Sbjct: 393 PKSIETDIRPISLTCHLAKAMEGFTLSRSLPGIVQHL 429 >SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1015 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 5/37 (13%) Frame = +2 Query: 122 PRPLETSLRPRALTC-----VSSFTMSMTSSGILKYL 217 P+ +ET +RP +LTC + FT+S + GI+++L Sbjct: 504 PKSIETDIRPISLTCHLAKAMEGFTLSRSLPGIVQHL 540 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 5/37 (13%) Frame = +2 Query: 122 PRPLETSLRPRALTC-----VSSFTMSMTSSGILKYL 217 P+ +ET +RP +LTC + FT+S + GI+++L Sbjct: 509 PKSIETDIRPISLTCHLAKAMEGFTLSRSLPGIVQHL 545 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 5/37 (13%) Frame = +2 Query: 122 PRPLETSLRPRALTC-----VSSFTMSMTSSGILKYL 217 P+ +ET +RP +LTC + FT+S + GI+++L Sbjct: 129 PKSIETDIRPISLTCHLAKAMEGFTLSRSLPGIVQHL 165 >SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063) Length = 376 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 5/37 (13%) Frame = +2 Query: 122 PRPLETSLRPRALTC-----VSSFTMSMTSSGILKYL 217 P+ +ET +RP +LTC + FT+S + GI+++L Sbjct: 129 PKSIETDIRPISLTCHLAKAMEGFTLSRSLPGIVQHL 165 >SB_51867| Best HMM Match : TP2 (HMM E-Value=9.2) Length = 370 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 67 AVTECASATTTATGPH 114 A +ECASATT+ TG H Sbjct: 124 AASECASATTSITGSH 139 >SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 736 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 122 PRPLETSLRPRALTC-VSSFTMSMTSSGILKYLI 220 PR +++ LRP +LTC +S S T S +L L+ Sbjct: 530 PRTIDSDLRPISLTCQISKVLESFTLSRMLPKLL 563 >SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 122 PRPLETSLRPRALTC-VSSFTMSMTSSGILKYLI 220 PR +++ LRP +LTC +S S T S +L L+ Sbjct: 616 PRTIDSDLRPISLTCQISKVLESFTLSRMLPKLL 649 >SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) Length = 867 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 122 PRPLETSLRPRALTC-VSSFTMSMTSSGILKYLI 220 PR +++ LRP +LTC +S S T S +L L+ Sbjct: 616 PRTIDSDLRPISLTCQISKVLESFTLSRMLPKLL 649 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,914,607 Number of Sequences: 59808 Number of extensions: 278193 Number of successful extensions: 751 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -