BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10m13r (514 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27720.1 68418.m03325 small nuclear ribonucleoprotein, putati... 171 2e-43 At1g20580.1 68414.m02569 small nuclear ribonucleoprotein, putati... 66 2e-11 At1g76300.1 68414.m08862 small nuclear ribonucleoprotein D3, put... 65 3e-11 At1g03330.1 68414.m00312 small nuclear ribonucleoprotein D, puta... 47 6e-06 At4g02840.1 68417.m00384 small nuclear ribonucleoprotein D1, put... 39 0.002 At3g07590.1 68416.m00909 small nuclear ribonucleoprotein D1, put... 37 0.007 At3g59810.1 68416.m06674 small nuclear ribonucleoprotein F, puta... 37 0.009 At4g30220.1 68417.m04298 small nuclear ribonucleoprotein F, puta... 35 0.028 At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, puta... 34 0.049 At1g05000.1 68414.m00501 tyrosine specific protein phosphatase f... 34 0.049 At4g03960.1 68417.m00559 tyrosine specific protein phosphatase f... 30 0.80 At2g32960.1 68415.m04040 tyrosine specific protein phosphatase f... 29 1.4 At3g02800.1 68416.m00272 tyrosine specific protein phosphatase f... 29 1.8 At5g16480.1 68418.m01926 tyrosine specific protein phosphatase f... 29 2.4 At5g44980.1 68418.m05516 F-box family protein contains F-box dom... 27 5.6 At3g15430.2 68416.m01958 regulator of chromosome condensation (R... 27 7.4 At3g15430.1 68416.m01957 regulator of chromosome condensation (R... 27 7.4 At1g08750.3 68414.m00974 GPI-anchor transamidase, putative simil... 27 9.8 At1g08750.2 68414.m00973 GPI-anchor transamidase, putative simil... 27 9.8 At1g08750.1 68414.m00972 GPI-anchor transamidase, putative simil... 27 9.8 >At5g27720.1 68418.m03325 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9QXA5 U6 snRNA-associated Sm-like protein LSm4 [Mus musculus] Length = 129 Score = 171 bits (416), Expect = 2e-43 Identities = 76/101 (75%), Positives = 87/101 (86%) Frame = -2 Query: 414 MLPLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECY 235 MLPLSLL+TAQ HPMLVELKNGETYNGHLV+CD WMNI+LREVICTS+DGD+FWRMPECY Sbjct: 1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60 Query: 234 IRGSTIKYLRIPDEVIDMVKEETQVKARGRNEVSKGRGQNM 112 IRG+TIKYLR+PDEVID V+EE R V +GRG+ + Sbjct: 61 IRGNTIKYLRVPDEVIDKVQEEKTRTDRKPPGVGRGRGRGV 101 >At1g20580.1 68414.m02569 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3, Sm-D3) [Mus musculus] SWISS-PROT:P43331 Length = 131 Score = 65.7 bits (153), Expect = 2e-11 Identities = 37/102 (36%), Positives = 61/102 (59%), Gaps = 5/102 (4%) Frame = -2 Query: 411 LPLSLLRTAQNHPMLVELKNGETYNGHLVSC-DNWMNINLREVICTSRDGDKFWRMPECY 235 +P+ LL A H + VELK+GE Y G ++ C DNW N L ++ T++DG K ++ + Sbjct: 7 IPVKLLHEASGHIVTVELKSGELYRGSMIECEDNW-NCQLEDITYTAKDG-KVSQLEHVF 64 Query: 234 IRGSTIKYLRIPD--EVIDMVKE-ETQVKARGRN-EVSKGRG 121 IRGS ++++ IPD + M K + ++K + + V +GRG Sbjct: 65 IRGSKVRFMVIPDILKHAPMFKRLDARIKGKSSSLGVGRGRG 106 >At1g76300.1 68414.m08862 small nuclear ribonucleoprotein D3, putative / snRNP core protein D3, putative / Sm protein D3, putative similar to SWISS-PROT:P43331 small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3, Sm-D3) [Mouse] Length = 128 Score = 64.9 bits (151), Expect = 3e-11 Identities = 36/104 (34%), Positives = 60/104 (57%), Gaps = 4/104 (3%) Frame = -2 Query: 411 LPLSLLRTAQNHPMLVELKNGETYNGHLVSC-DNWMNINLREVICTSRDGDKFWRMPECY 235 +P+ LL + H + VE+K+GE Y G ++ C DNW N L + T++DG K ++ + Sbjct: 7 IPVKLLHESSGHIVSVEMKSGELYRGSMIECEDNW-NCQLENITYTAKDG-KVSQLEHVF 64 Query: 234 IRGSTIKYLRIPDEVIDMVKEETQVKARGRNE---VSKGRGQNM 112 IRGS +++L IPD ++ V+ +G++ V +GRG M Sbjct: 65 IRGSLVRFLVIPD-MLKNAPMFKDVRGKGKSASLGVGRGRGAAM 107 >At1g03330.1 68414.m00312 small nuclear ribonucleoprotein D, putative / snRNP core SM-like protein, putative / U6 snRNA-associated Sm-like protein, putative similar to SWISS-PROT:Q9Y333 U6 snRNA-associated Sm-like protein LSm2 (Small nuclear ribonuclear protein D homolog, G7b, SnRNP core SM-like protein SM-x5) [Homo sapiens] Length = 93 Score = 47.2 bits (107), Expect = 6e-06 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 5/94 (5%) Frame = -2 Query: 414 MLPLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRM---P 244 ML S + + VELKN G L S D ++NI L D DK+ M Sbjct: 1 MLFFSYFKDLVGQEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVV--DQDKYPHMLSVR 58 Query: 243 ECYIRGSTIKYLRIP-DEV-IDMVKEETQVKARG 148 C+IRGS ++Y+++P D V +D++ + + +ARG Sbjct: 59 NCFIRGSVVRYVQLPKDGVDVDLLHDAARREARG 92 >At4g02840.1 68417.m00384 small nuclear ribonucleoprotein D1, putative / snRNP core protein D1, putative / Sm protein D1, putative similar to small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1, Sm-D1, Sm-D autoantigen) [Mouse] SWISS-PROT:P13641 Length = 116 Score = 38.7 bits (86), Expect = 0.002 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 7/100 (7%) Frame = -2 Query: 396 LRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTI 217 L N + +ELKNG +G + D MN +L+ V T + G + +RG+ I Sbjct: 7 LMKLNNETVSIELKNGTIVHGTITGVDVSMNTHLKAVKLTLK-GKNPVTLDHLSVRGNNI 65 Query: 216 KYLRIPDEV---IDMVKEETQVKAR----GRNEVSKGRGQ 118 +Y +PD + +V++ ++K + G+ +GRG+ Sbjct: 66 RYYILPDSLNLETLLVEDTPRIKPKKPTAGKIPAGRGRGR 105 >At3g07590.1 68416.m00909 small nuclear ribonucleoprotein D1, putative / snRNP core protein D1, putative / Sm protein D1, putative similar to SWISS-PROT:SP|P13641 small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1, Sm-D1, Sm-D autoantigen)[Mouse] Length = 114 Score = 37.1 bits (82), Expect = 0.007 Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 6/99 (6%) Frame = -2 Query: 396 LRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTI 217 L N + +ELKNG +G + D MN +L+ + S G + +RG+ I Sbjct: 7 LMKLNNETVSIELKNGTVVHGTITGVDVSMNTHLK-TVKMSLKGKNPVTLDHLSLRGNNI 65 Query: 216 KYLRIPDEV---IDMVKEETQVKAR---GRNEVSKGRGQ 118 +Y +PD + +V++ +VK + V +GRG+ Sbjct: 66 RYYILPDSLNLETLLVEDTPRVKPKKPVAGKAVGRGRGR 104 >At3g59810.1 68416.m06674 small nuclear ribonucleoprotein F, putative / U6 snRNA-associated Sm-like protein, putative / Sm protein F, putative similar to SWISS-PROT:Q9Y4Y8 U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] Length = 91 Score = 36.7 bits (81), Expect = 0.009 Identities = 18/67 (26%), Positives = 35/67 (52%) Frame = -2 Query: 408 PLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIR 229 P L++ + P++V+L +G Y G L D +MNI + + +G + + +IR Sbjct: 15 PADFLKSIRGRPVVVKLNSGVDYRGTLTCLDGYMNIAMEQTE-EYVNGQLKNKYGDAFIR 73 Query: 228 GSTIKYL 208 G+ + Y+ Sbjct: 74 GNNVLYI 80 >At4g30220.1 68417.m04298 small nuclear ribonucleoprotein F, putative / snRNP-F, putative / Sm protein F, putative similar to SWISS-PROT:Q15356 small nuclear ribonucleoprotein F (snRNP-F, Sm protein F, Sm-F, SmF) [Mouse] Length = 88 Score = 35.1 bits (77), Expect = 0.028 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = -2 Query: 420 IKMLPLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPE 241 I + P L ++V+LK G Y G L S D++MN+ L DG + E Sbjct: 4 IPVNPKPFLNNLTGKTVIVKLKWGMEYKGFLASVDSYMNLQLGNTE-EYIDGQLTGNLGE 62 Query: 240 CYIRGSTIKYLR-IPDE 193 IR + + Y+R +P++ Sbjct: 63 ILIRCNNVLYVRGVPED 79 >At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, putative / U6 snRNA-associated Sm-like protein, putative / Sm protein F, putative similar to SWISS-PROT:Q9Y4Y8 U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] Length = 91 Score = 34.3 bits (75), Expect = 0.049 Identities = 17/67 (25%), Positives = 34/67 (50%) Frame = -2 Query: 408 PLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIR 229 P L++ + P++V+L +G Y G L D +MNI + + +G + ++R Sbjct: 15 PADFLKSIRGKPVVVKLNSGVDYRGILTCLDGYMNIAMEQTE-EYVNGQLKNTYGDAFVR 73 Query: 228 GSTIKYL 208 G+ + Y+ Sbjct: 74 GNNVLYI 80 >At1g05000.1 68414.m00501 tyrosine specific protein phosphatase family protein contains tyrosine specific protein phosphatases active site, PROSITE:PS00383 Length = 215 Score = 34.3 bits (75), Expect = 0.049 Identities = 24/81 (29%), Positives = 38/81 (46%) Frame = -2 Query: 438 NEVDHYIKMLPLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDK 259 N DH I+M L +L +NHP+L+ K G+ G LV C + + C + D+ Sbjct: 125 NIPDHKIRMA-LKVLLDEKNHPVLIHCKRGKHRTGCLVGC-----LRKLQKWCLTSIFDE 178 Query: 258 FWRMPECYIRGSTIKYLRIPD 196 + R R S +++ I D Sbjct: 179 YQRFAAAKARVSDQRFMEIFD 199 >At4g03960.1 68417.m00559 tyrosine specific protein phosphatase family protein contains tyrosine specific protein phosphatases active site, PROSITE:PS00383 Length = 198 Score = 30.3 bits (65), Expect = 0.80 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 405 LSLLRTAQNHPMLVELKNGETYNGHLVSC 319 L +L +NHP+L+ K+G+ G LV C Sbjct: 111 LQVLLDTENHPVLIHCKSGKHRTGCLVGC 139 >At2g32960.1 68415.m04040 tyrosine specific protein phosphatase family protein contains Pfam profile PF03162: Putative tyrosine phosphatase family Length = 257 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 405 LSLLRTAQNHPMLVELKNGETYNGHLVSC 319 L +L +NHP+L+ K G+ G LV C Sbjct: 177 LKVLLDEKNHPLLIHCKRGKHRTGCLVGC 205 >At3g02800.1 68416.m00272 tyrosine specific protein phosphatase family protein contains tyrosine specific protein phosphatases active site, PROSITE:PS00383 Length = 199 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 405 LSLLRTAQNHPMLVELKNGETYNGHLVSC 319 L +L +NHP+L+ K G+ G LV C Sbjct: 93 LKVLVDVRNHPILIHCKRGKHRTGCLVGC 121 >At5g16480.1 68418.m01926 tyrosine specific protein phosphatase family protein contains tyrosine specific protein phosphatases active site, PROSITE:PS00383 Length = 204 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 405 LSLLRTAQNHPMLVELKNGETYNGHLVSC 319 L +L +NHP+L+ K G+ G LV C Sbjct: 96 LRVLVDVRNHPILIHCKRGKHRTGCLVGC 124 >At5g44980.1 68418.m05516 F-box family protein contains F-box domain Pfam:PF00646 Length = 435 Score = 27.5 bits (58), Expect = 5.6 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -2 Query: 330 LVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPD 196 L SC N N+ L + R+ F +P+C I ST++Y+ I + Sbjct: 336 LESCPNLKNLILEYNVELDREQVDFTNVPQCLI--STLEYVEIKE 378 >At3g15430.2 68416.m01958 regulator of chromosome condensation (RCC1) family protein low similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 488 Score = 27.1 bits (57), Expect = 7.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 143 LRPRALTCVSSFTMSMTSSGILKYLIVLPR 232 LRPR L C+ +S S+G+ ++V R Sbjct: 419 LRPRVLECLKPHRVSQVSTGLYHTIVVTQR 448 >At3g15430.1 68416.m01957 regulator of chromosome condensation (RCC1) family protein low similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 488 Score = 27.1 bits (57), Expect = 7.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 143 LRPRALTCVSSFTMSMTSSGILKYLIVLPR 232 LRPR L C+ +S S+G+ ++V R Sbjct: 419 LRPRVLECLKPHRVSQVSTGLYHTIVVTQR 448 >At1g08750.3 68414.m00974 GPI-anchor transamidase, putative similar to SP|P49018 GPI-anchor transamidase (EC 3.-.-.-) (GPI transamidase) {Saccharomyces cerevisiae}; contains Pfam profile PF01650: Peptidase C13 family Length = 388 Score = 26.6 bits (56), Expect = 9.8 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -2 Query: 300 NLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDE-VIDMVKEETQVKAR 151 N ++CTSR + M T+K L IPDE +I M+ ++ AR Sbjct: 27 NWAVLVCTSRFWFNYRHMANTLSLYRTVKRLGIPDERIILMLADDMACNAR 77 >At1g08750.2 68414.m00973 GPI-anchor transamidase, putative similar to SP|P49018 GPI-anchor transamidase (EC 3.-.-.-) (GPI transamidase) {Saccharomyces cerevisiae}; contains Pfam profile PF01650: Peptidase C13 family Length = 388 Score = 26.6 bits (56), Expect = 9.8 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -2 Query: 300 NLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDE-VIDMVKEETQVKAR 151 N ++CTSR + M T+K L IPDE +I M+ ++ AR Sbjct: 27 NWAVLVCTSRFWFNYRHMANTLSLYRTVKRLGIPDERIILMLADDMACNAR 77 >At1g08750.1 68414.m00972 GPI-anchor transamidase, putative similar to SP|P49018 GPI-anchor transamidase (EC 3.-.-.-) (GPI transamidase) {Saccharomyces cerevisiae}; contains Pfam profile PF01650: Peptidase C13 family Length = 388 Score = 26.6 bits (56), Expect = 9.8 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -2 Query: 300 NLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDE-VIDMVKEETQVKAR 151 N ++CTSR + M T+K L IPDE +I M+ ++ AR Sbjct: 27 NWAVLVCTSRFWFNYRHMANTLSLYRTVKRLGIPDERIILMLADDMACNAR 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,308,566 Number of Sequences: 28952 Number of extensions: 194257 Number of successful extensions: 506 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -