BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10m11r (758 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U72066-1|AAC14371.1| 897|Homo sapiens CtBP interacting protein ... 49 2e-05 BC030590-1|AAH30590.1| 902|Homo sapiens RBBP8 protein protein. 49 2e-05 AF043431-1|AAC34368.1| 897|Homo sapiens retinoblastoma-interact... 49 2e-05 BC130578-1|AAI30579.1| 1935|Homo sapiens ADAM metallopeptidase w... 31 4.5 AF488803-1|AAO15765.1| 1935|Homo sapiens a disintegrin-like and ... 31 4.5 AF261918-1|AAF89106.1| 1072|Homo sapiens disintegrin metalloprot... 31 4.5 AB037733-1|BAA92550.1| 1471|Homo sapiens KIAA1312 protein protein. 31 4.5 BC126405-1|AAI26406.1| 1613|Homo sapiens low density lipoprotein... 30 7.9 BC117136-1|AAI17137.1| 1613|Homo sapiens low density lipoprotein... 30 7.9 AF074264-1|AAC33006.1| 1613|Homo sapiens LDL receptor-related pr... 30 7.9 AB209683-1|BAD92920.1| 1477|Homo sapiens low density lipoprotein... 30 7.9 >U72066-1|AAC14371.1| 897|Homo sapiens CtBP interacting protein CtIP protein. Length = 897 Score = 48.8 bits (111), Expect = 2e-05 Identities = 22/59 (37%), Positives = 36/59 (61%) Frame = -1 Query: 740 IRKXXEKRALPGWSCEGCKNFYGELYKDDPVMLAKKIEECSKHRGRHNPERPKTPPNYW 564 +RK E+R L G +C+ C+ +Y ++ ++ KK+ CS+HR R+ P P TP N+W Sbjct: 799 VRKKEERRKLLGHTCKECEIYYADMPAEE---REKKLASCSRHRFRYIP--PNTPENFW 852 >BC030590-1|AAH30590.1| 902|Homo sapiens RBBP8 protein protein. Length = 902 Score = 48.8 bits (111), Expect = 2e-05 Identities = 22/59 (37%), Positives = 36/59 (61%) Frame = -1 Query: 740 IRKXXEKRALPGWSCEGCKNFYGELYKDDPVMLAKKIEECSKHRGRHNPERPKTPPNYW 564 +RK E+R L G +C+ C+ +Y ++ ++ KK+ CS+HR R+ P P TP N+W Sbjct: 804 VRKKEERRKLLGHTCKECEIYYADMPAEE---REKKLASCSRHRFRYIP--PNTPENFW 857 >AF043431-1|AAC34368.1| 897|Homo sapiens retinoblastoma-interacting protein protein. Length = 897 Score = 48.8 bits (111), Expect = 2e-05 Identities = 22/59 (37%), Positives = 36/59 (61%) Frame = -1 Query: 740 IRKXXEKRALPGWSCEGCKNFYGELYKDDPVMLAKKIEECSKHRGRHNPERPKTPPNYW 564 +RK E+R L G +C+ C+ +Y ++ ++ KK+ CS+HR R+ P P TP N+W Sbjct: 799 VRKKEERRKLLGHTCKECEIYYADMPAEE---REKKLASCSRHRFRYIP--PNTPENFW 852 >BC130578-1|AAI30579.1| 1935|Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 9 protein. Length = 1935 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 626 ECSKHRGRHNPERPKTPPNYWNPRWNVPEDTEELN 522 + S+H+ RH+ ++ KT W R N+ D LN Sbjct: 224 DTSEHKNRHSKDKKKTRARKWGERINLAGDVAALN 258 >AF488803-1|AAO15765.1| 1935|Homo sapiens a disintegrin-like and metalloprotease with thrombospondin type 1 motifs 9B protein. Length = 1935 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 626 ECSKHRGRHNPERPKTPPNYWNPRWNVPEDTEELN 522 + S+H+ RH+ ++ KT W R N+ D LN Sbjct: 224 DTSEHKNRHSKDKKKTRARKWGERINLAGDVAALN 258 >AF261918-1|AAF89106.1| 1072|Homo sapiens disintegrin metalloproteinase with thrombospondin repeats protein. Length = 1072 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 626 ECSKHRGRHNPERPKTPPNYWNPRWNVPEDTEELN 522 + S+H+ RH+ ++ KT W R N+ D LN Sbjct: 224 DTSEHKNRHSKDKKKTRARKWGERINLAGDVAALN 258 >AB037733-1|BAA92550.1| 1471|Homo sapiens KIAA1312 protein protein. Length = 1471 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 626 ECSKHRGRHNPERPKTPPNYWNPRWNVPEDTEELN 522 + S+H+ RH+ ++ KT W R N+ D LN Sbjct: 66 DTSEHKNRHSKDKKKTRARKWGERINLAGDVAALN 100 >BC126405-1|AAI26406.1| 1613|Homo sapiens low density lipoprotein receptor-related protein 6 protein. Length = 1613 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -1 Query: 347 KCATHLEM*VLRPQYSYNGCPTLQTETHYCFTAEIDGVVVPTRAD 213 +C+ + + +L+ + S PT + CFT EID + V R D Sbjct: 1227 RCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCD 1271 >BC117136-1|AAI17137.1| 1613|Homo sapiens low density lipoprotein receptor-related protein 6 protein. Length = 1613 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -1 Query: 347 KCATHLEM*VLRPQYSYNGCPTLQTETHYCFTAEIDGVVVPTRAD 213 +C+ + + +L+ + S PT + CFT EID + V R D Sbjct: 1227 RCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCD 1271 >AF074264-1|AAC33006.1| 1613|Homo sapiens LDL receptor-related protein 6 protein. Length = 1613 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -1 Query: 347 KCATHLEM*VLRPQYSYNGCPTLQTETHYCFTAEIDGVVVPTRAD 213 +C+ + + +L+ + S PT + CFT EID + V R D Sbjct: 1227 RCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCD 1271 >AB209683-1|BAD92920.1| 1477|Homo sapiens low density lipoprotein receptor-related protein 6 variant protein. Length = 1477 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -1 Query: 347 KCATHLEM*VLRPQYSYNGCPTLQTETHYCFTAEIDGVVVPTRAD 213 +C+ + + +L+ + S PT + CFT EID + V R D Sbjct: 1091 RCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCD 1135 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,198,953 Number of Sequences: 237096 Number of extensions: 2673835 Number of successful extensions: 5939 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 5719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5933 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9183116696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -