BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10m11f (556 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 23 1.8 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 23 1.8 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 3.1 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 7.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 9.5 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 200 YSRAFIILRVLCQILKYSKVNRRITKLSLKFKNKSVKV 313 +S F+I+R +C L KVN T+ L + S V Sbjct: 324 WSFGFLIVRTVCLCLFGGKVNDESTQPMLVLNSVSADV 361 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 200 YSRAFIILRVLCQILKYSKVNRRITKLSLKFKNKSVKV 313 +S F+I+R +C L KVN T+ L + S V Sbjct: 324 WSFGFLIVRTVCLCLFGGKVNDESTQPMLVLNSVSADV 361 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +1 Query: 271 YKTQFEIQKQKCESESCP 324 Y E Q+Q+C CP Sbjct: 477 YAKDLEKQRQQCNQNKCP 494 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 287 KFKNKSVKVNPVLV 328 K KNK KV P+L+ Sbjct: 98 KLKNKERKVKPLLI 111 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 20.6 bits (41), Expect = 9.5 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 366 IVFCIYYFF 340 I+ CIYYF+ Sbjct: 234 ILLCIYYFY 242 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.131 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,739 Number of Sequences: 336 Number of extensions: 1846 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13725787 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -