BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l24r (731 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10730.1 68417.m01753 protein kinase family protein contains ... 32 0.34 At3g53470.2 68416.m05903 expressed protein ribosomal protein S25... 31 0.79 At3g53470.1 68416.m05902 expressed protein ribosomal protein S25... 31 0.79 At5g40740.1 68418.m04944 expressed protein 29 3.2 At3g30300.1 68416.m03826 expressed protein contains Pfam PF03138... 28 7.3 At3g07400.1 68416.m00882 lipase class 3 family protein contains ... 28 7.3 At3g03540.1 68416.m00355 phosphoesterase family protein similar ... 27 9.7 >At4g10730.1 68417.m01753 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 708 Score = 32.3 bits (70), Expect = 0.34 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 3/96 (3%) Frame = -2 Query: 628 INARQERLVTNQVASAIENIRKQIREA-GFD-PLDVDRREIVIPPEEDFHALAAFAEDIK 455 IN+ E++ + + + ++ +R A F PL++ R + F + I Sbjct: 483 INSDSEKVHGYERSESERQLKSSVRRAPSFSGPLNLPNRASANSLSAPIKSSGGFRDSID 542 Query: 454 STGLSNIVIITNNFSILSARLNLVLSLP-RVEASVG 350 +N+V I FS+ S L+L + P R ASVG Sbjct: 543 DKSKANVVQIKGRFSVTSENLDLARASPLRKSASVG 578 >At3g53470.2 68416.m05903 expressed protein ribosomal protein S25, cytosolic, Arabidopsis thaliana, PIR:T08568 Length = 136 Score = 31.1 bits (67), Expect = 0.79 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = -2 Query: 583 AIENIRKQIREAGFDPLDVDRREIVIPPEEDFHALAAFAEDIKSTGLSNIVIITN-NFSI 407 A +N +KQ +++ F +VD+ PP +F L+ + IK T SN+++ T+ F++ Sbjct: 58 AWKNFKKQSKKSLFSQFNVDKYVTWNPPRSEFD-LSEEVDPIKRTERSNLMLWTSPRFTL 116 Query: 406 LSA 398 + A Sbjct: 117 VGA 119 >At3g53470.1 68416.m05902 expressed protein ribosomal protein S25, cytosolic, Arabidopsis thaliana, PIR:T08568 Length = 135 Score = 31.1 bits (67), Expect = 0.79 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = -2 Query: 583 AIENIRKQIREAGFDPLDVDRREIVIPPEEDFHALAAFAEDIKSTGLSNIVIITN-NFSI 407 A +N +KQ +++ F +VD+ PP +F L+ + IK T SN+++ T+ F++ Sbjct: 57 AWKNFKKQSKKSLFSQFNVDKYVTWNPPRSEFD-LSEEVDPIKRTERSNLMLWTSPRFTL 115 Query: 406 LSA 398 + A Sbjct: 116 VGA 118 >At5g40740.1 68418.m04944 expressed protein Length = 741 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -2 Query: 658 STQTFDEQTEINARQERLVTNQVASAIENIRKQIREA 548 S + +Q NAR + L T+ +S + N++K +REA Sbjct: 554 SEKNSTDQALSNARPDNLPTDTSSSFVHNLKKSVREA 590 >At3g30300.1 68416.m03826 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'auxin-independent growth promoter -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 677 Score = 27.9 bits (59), Expect = 7.3 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = -3 Query: 687 LFSPQFWLVPVHKLLMNRRR*THVKSAWSLTRLL-PPSKISESK*EKPDSIHWTLIEEKL 511 +F Q L+P+H + N T + ++W L ++ +K ++ K P SI +E K Sbjct: 363 VFGGQRTLIPLHGMFENVVDRTSLSTSWELAKMYGREAKHNDIKKMTPPSIE---VETKH 419 Query: 510 SSLQRKTSMHLPLSP 466 SL+ PL P Sbjct: 420 DSLKSTRQRPQPLPP 434 >At3g07400.1 68416.m00882 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 1003 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 484 ALAAFAEDIKSTGLSNIVIITNNFSI 407 ALA +++KS G+ ++ ITN FS+ Sbjct: 818 ALALLLDEVKSLGIPWVLAITNKFSV 843 >At3g03540.1 68416.m00355 phosphoesterase family protein similar to SP|P95246 Phospholipase C 2 precursor (EC 3.1.4.3) {Mycobacterium tuberculosis}; contains Pfam profile PF04185: Phosphoesterase family Length = 521 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 111 VCERKLVMVSERSRPNKLTFRSASTPPKVRSILRLLIE-IPETTL 242 +C+R V ++PN+L SA++ + +LLIE P+ T+ Sbjct: 145 ICDRWFASVPGATQPNRLFIHSATSHGTTNNERKLLIEGFPQKTI 189 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,403,905 Number of Sequences: 28952 Number of extensions: 287456 Number of successful extensions: 818 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -