BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l24f (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10730.1 68417.m01753 protein kinase family protein contains ... 32 0.29 At3g53470.2 68416.m05903 expressed protein ribosomal protein S25... 31 0.67 At3g53470.1 68416.m05902 expressed protein ribosomal protein S25... 31 0.67 At5g40740.1 68418.m04944 expressed protein 29 2.7 At5g10250.1 68418.m01190 phototropic-responsive protein, putativ... 29 2.7 At3g30300.1 68416.m03826 expressed protein contains Pfam PF03138... 28 6.2 At3g07400.1 68416.m00882 lipase class 3 family protein contains ... 28 6.2 At3g03540.1 68416.m00355 phosphoesterase family protein similar ... 27 8.2 >At4g10730.1 68417.m01753 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 708 Score = 32.3 bits (70), Expect = 0.29 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 3/96 (3%) Frame = +3 Query: 105 INARQERLVTNQVASAIENIRKQIREA-GFD-PLDVDRREIVIPPEEDFHALAAFAEDIK 278 IN+ E++ + + + ++ +R A F PL++ R + F + I Sbjct: 483 INSDSEKVHGYERSESERQLKSSVRRAPSFSGPLNLPNRASANSLSAPIKSSGGFRDSID 542 Query: 279 STGLSNIVIITNNFSILSARLNLVLSLP-RVEASVG 383 +N+V I FS+ S L+L + P R ASVG Sbjct: 543 DKSKANVVQIKGRFSVTSENLDLARASPLRKSASVG 578 >At3g53470.2 68416.m05903 expressed protein ribosomal protein S25, cytosolic, Arabidopsis thaliana, PIR:T08568 Length = 136 Score = 31.1 bits (67), Expect = 0.67 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +3 Query: 150 AIENIRKQIREAGFDPLDVDRREIVIPPEEDFHALAAFAEDIKSTGLSNIVIITN-NFSI 326 A +N +KQ +++ F +VD+ PP +F L+ + IK T SN+++ T+ F++ Sbjct: 58 AWKNFKKQSKKSLFSQFNVDKYVTWNPPRSEFD-LSEEVDPIKRTERSNLMLWTSPRFTL 116 Query: 327 LSA 335 + A Sbjct: 117 VGA 119 >At3g53470.1 68416.m05902 expressed protein ribosomal protein S25, cytosolic, Arabidopsis thaliana, PIR:T08568 Length = 135 Score = 31.1 bits (67), Expect = 0.67 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +3 Query: 150 AIENIRKQIREAGFDPLDVDRREIVIPPEEDFHALAAFAEDIKSTGLSNIVIITN-NFSI 326 A +N +KQ +++ F +VD+ PP +F L+ + IK T SN+++ T+ F++ Sbjct: 57 AWKNFKKQSKKSLFSQFNVDKYVTWNPPRSEFD-LSEEVDPIKRTERSNLMLWTSPRFTL 115 Query: 327 LSA 335 + A Sbjct: 116 VGA 118 >At5g40740.1 68418.m04944 expressed protein Length = 741 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 75 STQTFDEQTEINARQERLVTNQVASAIENIRKQIREA 185 S + +Q NAR + L T+ +S + N++K +REA Sbjct: 554 SEKNSTDQALSNARPDNLPTDTSSSFVHNLKKSVREA 590 >At5g10250.1 68418.m01190 phototropic-responsive protein, putative similar to root phototropism RPT2 [Arabidopsis thaliana] gi|6959488|gb|AAF33112, a signal transducer of phototropic response PMID:10662859 Length = 607 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Frame = -1 Query: 221 NFSSINVQWIESGFSYL-LSDIFDGGSNLVSDQALLTCVYLRLFIKSLCTGTS-QNCGEN 48 + + +NV + YL +++ F+ G+ + +A +T V L + +L S N Sbjct: 118 DLNPLNVAPLRCASEYLYMTEEFEAGNLISKTEAFITFVVLASWRDTLTVLRSCTNLSPW 177 Query: 47 NENLHDVRACCKMI 6 ENL VR CC ++ Sbjct: 178 AENLQIVRRCCDLL 191 >At3g30300.1 68416.m03826 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'auxin-independent growth promoter -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 677 Score = 27.9 bits (59), Expect = 6.2 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = +1 Query: 46 LFSPQFWLVPVHKLLMNRRR*THVKSAWSLTRLL-PPSKISESK*EKPDSIHWTLIEEKL 222 +F Q L+P+H + N T + ++W L ++ +K ++ K P SI +E K Sbjct: 363 VFGGQRTLIPLHGMFENVVDRTSLSTSWELAKMYGREAKHNDIKKMTPPSIE---VETKH 419 Query: 223 SSLQRKTSMHLPLSP 267 SL+ PL P Sbjct: 420 DSLKSTRQRPQPLPP 434 >At3g07400.1 68416.m00882 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 1003 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +3 Query: 249 ALAAFAEDIKSTGLSNIVIITNNFSI 326 ALA +++KS G+ ++ ITN FS+ Sbjct: 818 ALALLLDEVKSLGIPWVLAITNKFSV 843 >At3g03540.1 68416.m00355 phosphoesterase family protein similar to SP|P95246 Phospholipase C 2 precursor (EC 3.1.4.3) {Mycobacterium tuberculosis}; contains Pfam profile PF04185: Phosphoesterase family Length = 521 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 622 VCERKLVMVSERSRPNKLTFRSASTPPKVRSILRLLIE-IPETTL 491 +C+R V ++PN+L SA++ + +LLIE P+ T+ Sbjct: 145 ICDRWFASVPGATQPNRLFIHSATSHGTTNNERKLLIEGFPQKTI 189 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,232,937 Number of Sequences: 28952 Number of extensions: 258868 Number of successful extensions: 731 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -