BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l23r (672 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 31 0.011 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 1.3 AY531876-1|AAT08870.1| 38|Tribolium castaneum unknown protein. 23 3.0 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 4.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 6.9 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 9.2 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 9.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.2 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 30.7 bits (66), Expect = 0.011 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 5/85 (5%) Frame = -3 Query: 241 DDEDSFKR---QFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKEL--KKDSVKQKRW 77 +D+D +K+ QFSK IKLG+ D+ K E +R S E KD V + + Sbjct: 418 EDKDGYKKFYEQFSKNIKLGIHEDSQNR--AKLSELLRYHTSASGDEACSLKDYVSRIKP 475 Query: 76 NKRKLTLAERKNRIKQKKASFIKRL 2 N++ + +++ + +SF++R+ Sbjct: 476 NQKHIYYITGESKEQVANSSFVERV 500 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 440 CRLSTHHYWCSCLWSYEG 387 C+ T HY C C + Y G Sbjct: 76 CQDHTTHYTCHCPYGYTG 93 >AY531876-1|AAT08870.1| 38|Tribolium castaneum unknown protein. Length = 38 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -2 Query: 116 ERVKERLCQTEALEQTQANIGREEKQ 39 +R+ E + QTE++E + IGR ++ Sbjct: 11 KRLFEHMLQTESIEPVKMAIGRPSEK 36 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 4.0 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -3 Query: 253 SLEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKK 116 ++E+DDED+ ++ I + + + KK H ++ P KK Sbjct: 475 AVEEDDEDAIEKPAPVKISVQEVLNRVRKPTKKLH--LKNSPISKK 518 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 550 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNK 648 E + +L ++ LNM Q + SH ++ VN+ Sbjct: 301 EQMNLLHSNDLNMHQQHHQQNMSHEELSAMVNR 333 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 9.2 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 366 LRPPSTAPFIAPKT 407 L PP++ P ++PK+ Sbjct: 106 LTPPNSEPLVSPKS 119 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -2 Query: 401 WSYEGCC*RWPQCSSFHQKIPWL*CRIQ 318 WS W CSSF Q+ C I+ Sbjct: 403 WSVNAGMWMWLSCSSFFQQFFHCYCPIK 430 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 550 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 657 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 550 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 657 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 550 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 657 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 550 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 657 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,989 Number of Sequences: 336 Number of extensions: 2949 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -