BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l18r (735 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 24 5.6 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 23 9.8 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 23.8 bits (49), Expect = 5.6 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 214 WYFILIIILKDYSVNLCRHLKPPVFLQPTLC 306 WY +++ L+ Y + + P L P LC Sbjct: 36 WYLCIMMALQHYLTMIGAIVSIPFILTPALC 66 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +2 Query: 311 SIEHLTGKIRDSETLNNFPLS--IGN 382 S + GK++DS L+ P+S +GN Sbjct: 233 SSSEIYGKVKDSSVLDGIPISAILGN 258 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,555 Number of Sequences: 2352 Number of extensions: 15753 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -